30S ribosomal protein S17

Details

Name
30S ribosomal protein S17
Kind
protein
Synonyms
Not Available
Gene Name
rpsQ
UniProtKB Entry
P0DOY7Swiss-Prot
Organism
Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
NCBI Taxonomy ID
300852
Amino acid sequence
>lcl|BSEQ0051262|30S ribosomal protein S17
MPKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEII
ESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Number of residues
105
Molecular Weight
12297.52
Theoretical pI
Not Available
GO Classification
Functions
rRNA binding / structural constituent of ribosome
Processes
translation
Components
ribosome
General Function
One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it helps nucleate assembly of the platform and body of the 30S subunit by bringing together and stabilizing interactions between several different RNA helices. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.
Specific Function
rRNA binding
Pfam Domain Function
Signal Regions
Not Available
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
Not Available
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP0DOY7
UniProtKB Entry NameRS17_THET8
PDB ID(s)1FJG, 1HNW, 1HNX, 1HNZ, 1HR0, 1I94, 1I95, 1I96, 1I97, 1IBK, 1IBL, 1IBM, 1J5E, 1JGO, 1JGP, 1JGQ, 1L1U, 1ML5, 1N32, 1N33, 1N34, 1N36, 1VVJ, 1VY4, 1VY5, 1VY6, 1VY7, 1XMO, 1XMQ, 1XNQ, 1XNR, 2E5L, 2F4V, 2HHH, 2UU9, 2UUA, 2UUB, 2UUC, 2UXB, 2UXC, 2UXD, 2ZM6, 3OTO, 3T1H, 3T1Y, 4AQY, 4B3M, 4B3R, 4B3S, 4B3T, 4DR1, 4DR2, 4DR3, 4DR4, 4DR5, 4DR6, 4DR7, 4DUY, 4DUZ, 4DV0, 4DV1, 4DV2, 4DV3, 4DV4, 4DV5, 4DV6, 4DV7, 4GKJ, 4GKK, 4JI0, 4JI1, 4JI2, 4JI3, 4JI4, 4JI5, 4JI6, 4JI7, 4JI8, 4JV5, 4JYA, 4K0K, 4KHP, 4L47, 4L71, 4LEL, 4LF4, 4LF5, 4LF6, 4LF7, 4LF8, 4LF9, 4LFA, 4LFB, 4LFC, 4LFZ, 4LNT, 4LSK, 4LT8, 4NXM, 4NXN, 4OX9, 4P6F, 4P70, 4TUA, 4TUB, 4TUC, 4TUD, 4TUE, 4V42, 4V49, 4V4G, 4V4I, 4V4P, 4V4R, 4V4S, 4V4T, 4V4X, 4V4Y, 4V4Z, 4V51, 4V5A, 4V5C, 4V5D, 4V5E, 4V5F, 4V5G, 4V5J, 4V5K, 4V5L, 4V5M, 4V5N, 4V5P, 4V5Q, 4V5R, 4V5S, 4V68, 4V6A, 4V6F, 4V6G, 4V7J, 4V7K, 4V7L, 4V7M, 4V7W, 4V7X, 4V7Y, 4V7Z, 4V87, 4V8A, 4V8B, 4V8C, 4V8D, 4V8E, 4V8F, 4V8G, 4V8H, 4V8I, 4V8J, 4V8N, 4V8O, 4V8Q, 4V8U, 4V8X, 4V90, 4V95, 4V97, 4V9A, 4V9B, 4V9H, 4V9I, 4V9R, 4V9S, 4W2E, 4W2F, 4W2G, 4W2H, 4W2I, 4W4G, 4WPO, 4WQ1, 4WQF, 4WQR, 4WQU, 4WQY, 4WR6, 4WRA, 4WRO, 4WSD, 4WSM, 4WT1, 4WT8, 4WU1, 4WZD, 4WZO, 4X62, 4X64, 4X65, 4X66, 4Y4O, 4Y4P, 4YHH, 4YPB, 4YY3, 4YZV, 4Z3S, 4Z8C, 4ZER, 4ZSN, 5A9Z, 5AA0, 5BR8, 5CZP, 5D8B, 5DFE, 5DOX, 5DOY, 5E7K, 5E81, 5EL4, 5EL5, 5EL6, 5EL7, 5F8K, 5FDU, 5FDV, 5HAU, 5HCP, 5HCQ, 5HCR, 5HD1, 5IB7, 5IB8, 5IBB, 5IWA, 5J30, 5J3C, 5J4B, 5J4C, 5J8B, 5LMN, 5LMO, 5LMP, 5LMQ, 5LMR, 5LMS, 5LMT, 5LMU, 5LMV
NCBI Gene ID3169831
General References
  1. Tsiboli P, Herfurth E, Choli T: Purification and characterization of the 30S ribosomal proteins from the bacterium Thermus thermophilus. Eur J Biochem. 1994 Nov 15;226(1):169-77. [Article]
  2. Simitsopoulou M, Avila H, Franceschi F: Ribosomal gene disruption in the extreme thermophile Thermus thermophilus HB8. Generation of a mutant lacking ribosomal protein S17. Eur J Biochem. 1999 Dec;266(2):524-32. [Article]
  3. Suh MJ, Hamburg DM, Gregory ST, Dahlberg AE, Limbach PA: Extending ribosomal protein identifications to unsequenced bacterial strains using matrix-assisted laser desorption/ionization mass spectrometry. Proteomics. 2005 Dec;5(18):4818-31. [Article]
  4. Clemons WM Jr, May JL, Wimberly BT, McCutcheon JP, Capel MS, Ramakrishnan V: Structure of a bacterial 30S ribosomal subunit at 5.5 A resolution. Nature. 1999 Aug 26;400(6747):833-40. doi: 10.1038/23631. [Article]
  5. Wimberly BT, Brodersen DE, Clemons WM Jr, Morgan-Warren RJ, Carter AP, Vonrhein C, Hartsch T, Ramakrishnan V: Structure of the 30S ribosomal subunit. Nature. 2000 Sep 21;407(6802):327-39. [Article]
  6. Schluenzen F, Tocilj A, Zarivach R, Harms J, Gluehmann M, Janell D, Bashan A, Bartels H, Agmon I, Franceschi F, Yonath A: Structure of functionally activated small ribosomal subunit at 3.3 angstroms resolution. Cell. 2000 Sep 1;102(5):615-23. [Article]
  7. Brodersen DE, Clemons WM Jr, Carter AP, Morgan-Warren RJ, Wimberly BT, Ramakrishnan V: The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit. Cell. 2000 Dec 22;103(7):1143-54. [Article]
  8. Carter AP, Clemons WM, Brodersen DE, Morgan-Warren RJ, Wimberly BT, Ramakrishnan V: Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics. Nature. 2000 Sep 21;407(6802):340-8. [Article]
  9. Yusupova GZ, Yusupov MM, Cate JH, Noller HF: The path of messenger RNA through the ribosome. Cell. 2001 Jul 27;106(2):233-41. [Article]
  10. Pioletti M, Schlunzen F, Harms J, Zarivach R, Gluhmann M, Avila H, Bashan A, Bartels H, Auerbach T, Jacobi C, Hartsch T, Yonath A, Franceschi F: Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3. EMBO J. 2001 Apr 17;20(8):1829-39. [Article]
  11. Carter AP, Clemons WM Jr, Brodersen DE, Morgan-Warren RJ, Hartsch T, Wimberly BT, Ramakrishnan V: Crystal structure of an initiation factor bound to the 30S ribosomal subunit. Science. 2001 Jan 19;291(5503):498-501. [Article]
  12. Yusupov MM, Yusupova GZ, Baucom A, Lieberman K, Earnest TN, Cate JH, Noller HF: Crystal structure of the ribosome at 5.5 A resolution. Science. 2001 May 4;292(5518):883-96. Epub 2001 Mar 29. [Article]
  13. Ogle JM, Brodersen DE, Clemons WM Jr, Tarry MJ, Carter AP, Ramakrishnan V: Recognition of cognate transfer RNA by the 30S ribosomal subunit. Science. 2001 May 4;292(5518):897-902. [Article]
  14. Brodersen DE, Clemons WM Jr, Carter AP, Wimberly BT, Ramakrishnan V: Crystal structure of the 30 S ribosomal subunit from Thermus thermophilus: structure of the proteins and their interactions with 16 S RNA. J Mol Biol. 2002 Feb 22;316(3):725-68. [Article]
  15. Petry S, Brodersen DE, Murphy FV 4th, Dunham CM, Selmer M, Tarry MJ, Kelley AC, Ramakrishnan V: Crystal structures of the ribosome in complex with release factors RF1 and RF2 bound to a cognate stop codon. Cell. 2005 Dec 29;123(7):1255-66. [Article]
  16. Weixlbaumer A, Jin H, Neubauer C, Voorhees RM, Petry S, Kelley AC, Ramakrishnan V: Insights into translational termination from the structure of RF2 bound to the ribosome. Science. 2008 Nov 7;322(5903):953-6. doi: 10.1126/science.1164840. [Article]
  17. Jin H, Kelley AC, Loakes D, Ramakrishnan V: Structure of the 70S ribosome bound to release factor 2 and a substrate analog provides insights into catalysis of peptide release. Proc Natl Acad Sci U S A. 2010 May 11;107(19):8593-8. doi: 10.1073/pnas.1003995107. Epub 2010 Apr 26. [Article]

Associated Data

Drug Relations
DrugDrug groupPharmacological action?TypeActionsDetails
2-METHYLTHIO-N6-ISOPENTENYL-ADENOSINE-5'-MONOPHOSPHATEexperimentalunknowntargetDetails