30S ribosomal protein S3
Details
- Name
- 30S ribosomal protein S3
- Kind
- protein
- Synonyms
- Not Available
- Gene Name
- rpsC
- UniProtKB Entry
- P0A7V3Swiss-Prot
- Organism
- Escherichia coli (strain K12)
- NCBI Taxonomy ID
- 83333
- Amino acid sequence
>lcl|BSEQ0013240|30S ribosomal protein S3 MGQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERP AKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSI TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRKGRK
- Number of residues
- 233
- Molecular Weight
- 25983.07
- Theoretical pI
- Not Available
- GO Classification
- FunctionsmRNA binding / rRNA binding / structural constituent of ribosomeProcessestranslationComponentscytosol / cytosolic small ribosomal subunit
- General Function
- Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation (By similarity).
- Specific Function
- mRNA binding
- Pfam Domain Function
- KH_2 (PF07650)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0013241|30S ribosomal protein S3 (rpsC) ATGGGTCAGAAAGTACATCCTAATGGTATTCGCCTGGGTATTGTAAAACCATGGAACTCT ACCTGGTTTGCGAACACCAAAGAATTCGCTGACAACCTGGACAGCGATTTTAAAGTACGT CAGTACCTGACTAAGGAACTGGCTAAAGCGTCCGTATCTCGTATCGTTATCGAGCGTCCG GCTAAGAGCATCCGTGTAACCATTCACACTGCTCGCCCGGGTATCGTTATCGGTAAAAAA GGTGAAGACGTAGAAAAACTGCGTAAGGTCGTAGCGGACATCGCTGGCGTTCCTGCACAG ATCAACATCGCCGAAGTTCGTAAGCCTGAACTGGACGCAAAACTGGTTGCTGACAGCATC ACTTCTCAGCTGGAACGTCGCGTTATGTTCCGTCGTGCTATGAAGCGTGCTGTACAGAAC GCAATGCGTCTGGGCGCTAAAGGTATTAAAGTTGAAGTTAGCGGCCGTCTGGGCGGCGCG GAAATCGCACGTACCGAATGGTACCGCGAAGGTCGCGTACCGCTGCACACTCTGCGTGCT GACATCGACTACAACACCTCTGAAGCGCACACCACTTACGGTGTAATCGGCGTTAAAGTG TGGATCTTCAAAGGCGAGATCCTGGGTGGTATGGCTGCTGTTGAACAACCGGAAAAACCG GCTGCTCAGCCTAAAAAGCAGCAGCGTAAAGGCCGTAAATAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0A7V3 UniProtKB Entry Name RS3_ECOLI PDB ID(s) 1M5G, 2YKR, 3J9Y, 3J9Z, 3JA1, 4A2I, 4ADV, 4ODQ, 4U1U, 4U1V, 4U20, 4U24, 4U25, 4U26, 4U27, 4V47, 4V48, 4V4H, 4V4Q, 4V4V, 4V4W, 4V50, 4V52, 4V53, 4V54, 4V55, 4V56, 4V57, 4V5B, 4V5H, 4V5Y, 4V64, 4V65, 4V66, 4V69, 4V6C, 4V6D, 4V6E, 4V6K, 4V6L, 4V6M, 4V6N, 4V6O, 4V6P, 4V6Q, 4V6R, 4V6S, 4V6T, 4V6V, 4V6Y, 4V6Z, 4V70, 4V71, 4V72, 4V73, 4V74, 4V75, 4V76, 4V77, 4V78, 4V79, 4V7A, 4V7B, 4V7C, 4V7D, 4V7I, 4V7S, 4V7T, 4V7U, 4V7V, 4V85, 4V89, 4V9C, 4V9D, 4V9O, 4V9P, 4WF1, 4WOI, 4WWW, 4YBB, 5AFI KEGG ID ecj:JW3276 NCBI Gene ID 23846857 - General References
- Zurawski G, Zurawski SM: Structure of the Escherichia coli S10 ribosomal protein operon. Nucleic Acids Res. 1985 Jun 25;13(12):4521-6. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Brauer D, Roming R: The primary structure of protein S3 from the small ribosomal subunit of Escherichia coli. FEBS Lett. 1979 Oct 15;106(2):352-7. [Article]
- Urlaub H, Kruft V, Bischof O, Muller EC, Wittmann-Liebold B: Protein-rRNA binding features and their structural and functional implications in ribosomes as determined by cross-linking studies. EMBO J. 1995 Sep 15;14(18):4578-88. [Article]
- Choi KM, Atkins JF, Gesteland RF, Brimacombe R: Flexibility of the nascent polypeptide chain within the ribosome--contacts from the peptide N-terminus to a specific region of the 30S subunit. Eur J Biochem. 1998 Jul 15;255(2):409-13. [Article]
- Takyar S, Hickerson RP, Noller HF: mRNA helicase activity of the ribosome. Cell. 2005 Jan 14;120(1):49-58. [Article]
- Arnold RJ, Reilly JP: Observation of Escherichia coli ribosomal proteins and their posttranslational modifications by mass spectrometry. Anal Biochem. 1999 Apr 10;269(1):105-12. [Article]
- Tung CS, Joseph S, Sanbonmatsu KY: All-atom homology model of the Escherichia coli 30S ribosomal subunit. Nat Struct Biol. 2002 Oct;9(10):750-5. [Article]
- Gao H, Sengupta J, Valle M, Korostelev A, Eswar N, Stagg SM, Van Roey P, Agrawal RK, Harvey SC, Sali A, Chapman MS, Frank J: Study of the structural dynamics of the E coli 70S ribosome using real-space refinement. Cell. 2003 Jun 13;113(6):789-801. [Article]
- Schuwirth BS, Borovinskaya MA, Hau CW, Zhang W, Vila-Sanjurjo A, Holton JM, Cate JH: Structures of the bacterial ribosome at 3.5 A resolution. Science. 2005 Nov 4;310(5749):827-34. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Tetracycline approved, vet_approved, withdrawn yes target inhibitor Details Chlortetracycline approved, investigational, vet_approved yes target inhibitor Details Omadacycline approved, investigational yes target inhibitor Details