Transcription factor RelB
Details
- Name
- Transcription factor RelB
- Kind
- protein
- Synonyms
- I-Rel
- Gene Name
- RELB
- UniProtKB Entry
- Q01201Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0056909|Transcription factor RelB MLRSGPASGPSVPTGRAMPSRRVARPPAAPELGALGSPDLSSLSLAVSRSTDELEIIDEY IKENGFGLDGGQPGPGEGLPRLVSRGAASLSTVTLGPVAPPATPPPWGCPLGRLVSPAPG PGPQPHLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEV TACLVWKDWPHRVHPHSLVGKDCTDGICRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIE RKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGQMRRMDPVLSEPVYDKKSTNT SELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSRASWEGRADFSQADVHRQIAIV FKTPPYEDLEIVEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGMPDVLG ELNSSDPHGIESKRRKKKPAILDHFLPNHGSGPFLPPSALLPDPDFFSGTVSLPGLEPPG GPDLLDDGFAYDPTAPTLFTMLDLLPPAPPHASAVVCSGGAGAVVGETPGPEPLTLDSYQ APGPGDGGTASLVGSNMFPNHYREAAFGGGLLSPGPEAT
- Number of residues
- 579
- Molecular Weight
- 62133.86
- Theoretical pI
- Not Available
- GO Classification
- Not Available
- General Function
- NF-kappa-B is a pleiotropic transcription factor which is present in almost all cell types and is involved in many biological processed such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52. The dimers bind at kappa-B sites in the DNA of their target genes and the individual dimers have distinct preferences for different kappa-B sites that they can bind with distinguishable affinity and specificity. Different dimer combinations act as transcriptional activators or repressors, respectively. NF-kappa-B is controlled by various mechanisms of post-translational modification and subcellular compartmentalization as well as by interactions with other cofactors or corepressors. NF-kappa-B complexes are held in the cytoplasm in an inactive state complexed with members of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activation pathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs) in response to different activators, subsequently degraded thus liberating the active NF-kappa-B complex which translocates to the nucleus. NF-kappa-B heterodimeric RelB-p50 and RelB-p52 complexes are transcriptional activators. RELB neither associates with DNA nor with RELA/p65 or REL. Stimulates promoter activity in the presence of NFKB2/p49. As a member of the NUPR1/RELB/IER3 survival pathway, may provide pancreatic ductal adenocarcinoma with remarkable resistance to cell stress, such as starvation or gemcitabine treatment. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-BMAL1 heterodimer in a CRY1/CRY2 independent manner. Increased repression of the heterodimer is seen in the presence of NFKB2/p52. Is required for both T and B lymphocyte maturation and function (PubMed:26385063)
- Specific Function
- DNA-binding transcription factor activity, RNA polymerase II-specific
- Pfam Domain Function
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Nucleus
- Gene sequence
- Not Available
- Chromosome Location
- 19
- Locus
- 19q13.32
- External Identifiers
Resource Link UniProtKB ID Q01201 UniProtKB Entry Name RELB_HUMAN GeneCard ID RELB HGNC ID HGNC:9956 PDB ID(s) 8G8R KEGG ID hsa:5971 NCBI Gene ID 5971 - General References
- Not Available
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details (4R,5R)-1,2-dithiane-4,5-diol experimental yes target inhibitor Details Go-6976 investigational yes target inhibitor Details Rocaglamide experimental yes target inhibitor Details Tyloxapol approved, investigational yes target inhibitor Details Tepilamide fumarate investigational yes target inhibitor Details Recoflavone investigational yes target modulator Details Vadimezan investigational yes target modulator Details Edasalonexent investigational yes target inhibitor Details Triptolide investigational yes target inhibitor Details Laquinimod investigational yes target modulator Details Sulfasalazine approved yes target activator Details Parthenolide approved, investigational yes target inhibitor Details