Gamma-secretase subunit APH-1B
Details
- Name
- Gamma-secretase subunit APH-1B
- Kind
- protein
- Synonyms
- APH-1b
- Aph-1beta
- Presenilin-stabilization factor-like
- PSFL
- Gene Name
- APH1B
- UniProtKB Entry
- Q8WW43Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0060503|Gamma-secretase subunit APH-1B MTAAVFFGCAFIAFGPALALYVFTIATEPLRIIFLIAGAFFWLVSLLISSLVWFMARVII DNKDGPTQKYLLIFGAFVSVYIQEMFRFAYYKLLKKASEGLKSINPGETAPSMRLLAYVS GLGFGIMSGVFSFVNTLSDSLGPGTVGIHGDSPQFFLYSAFMTLVIILLHVFWGIVFFDG CEKKKWGILLIVLLTHLLVSAQTFISSYYGINLASAFIILVLMGTWAFLAAGGSCRSLKL CLLCQDKNFLLYNQRSR
- Number of residues
- 257
- Molecular Weight
- 28459.6
- Theoretical pI
- Not Available
- GO Classification
- Functionsendopeptidase activator activity / protein-macromolecule adaptor activityProcessesamyloid precursor protein catabolic process / amyloid-beta formation / membrane protein intracellular domain proteolysis / Notch receptor processing / Notch signaling pathway / positive regulation of endopeptidase activity / protein processingComponentsendoplasmic reticulum / endoplasmic reticulum membrane / endosome membrane / gamma-secretase complex / Golgi membrane / membrane / plasma membrane / transport vesicle
- General Function
- Probable subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral proteins such as Notch receptors and APP (amyloid-beta precursor protein). It probably represents a stabilizing cofactor for the presenilin homodimer that promotes the formation of a stable complex. Probably present in a minority of gamma-secretase complexes compared to APH1A
- Specific Function
- endopeptidase activator activity
- Pfam Domain Function
- Aph-1 (PF06105)
- Signal Regions
- Not Available
- Transmembrane Regions
- 5-25 32-52 71-91 115-135 158-178 186-206 213-233
- Cellular Location
- Membrane
- Gene sequence
- Not Available
- Chromosome Location
- 15
- Locus
- 15q22.2
- External Identifiers
Resource Link UniProtKB ID Q8WW43 UniProtKB Entry Name APH1B_HUMAN GeneCard ID APH1B HGNC ID HGNC:24080 PDB ID(s) 8OQY, 8OQZ KEGG ID hsa:83464 NCBI Gene ID 83464 - General References
- Not Available
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Esflurbiprofen investigational yes target inhibitor Details Begacestat investigational yes target modulator Details E-2012 investigational yes target modulator Details GSI-136 investigational yes target modulator Details MK-0752 investigational yes target modulator Details Avagacestat investigational yes target modulator Details Itanapraced investigational yes target modulator Details RG-4733 investigational yes target modulator Details Nirogacestat approved, investigational yes target modulator Details Semagacestat investigational yes target modulator Details Tarenflurbil investigational yes target inhibitor Details