Nicastrin
Details
- Name
- Nicastrin
- Kind
- protein
- Synonyms
- KIAA0253
- Gene Name
- NCSTN
- UniProtKB Entry
- Q92542Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0060736|Nicastrin MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQI GCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAG LAVSLTKPSPASGFSPSVQCPNDGFGVYSNSYGPEFAHCREIQWNSLGNGLAYEDFSFPI FLLEDENETKVIKQCYQDHNLSQNGSAPTFPLCAMQLFSHMHAVISTATCMRRSSIQSTF SINPEIVCDPLSDYNVWSMLKPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVA SFVTQLAAAEALQKAPDVTTLPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVD SFVELGQVALRTSLELWMHTDPVSQKNESVRNQVEDLLATLEKSGAGVPAVILRRPNQSQ PLPPSSLQRFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFV TDTAKALADVATVLGRALYELAGGTNFSDTVQADPQTVTRLLYGFLIKANNSWFQSILRQ DLRSYLGDGPLQHYIAVSSPTNTTYVVQYALANLTGTVVNLTREQCQDPSKVPSENKDLY EYSWVQGPLHSNETDRLPRCVRSTARLARALSPAFELSQWSSTEYSTWTESRWKDIRARI FLIASKELELITLTVGFGILIFSLIVTYCINAKADVLFIAPREPGAVSY
- Number of residues
- 709
- Molecular Weight
- 78410.16
- Theoretical pI
- Not Available
- GO Classification
- Functionsaspartic endopeptidase activity, intramembrane cleaving / ATPase binding / growth factor receptor binding / protein-macromolecule adaptor activityProcessesadult behavior / amyloid precursor protein biosynthetic process / amyloid precursor protein catabolic process / amyloid precursor protein metabolic process / amyloid-beta formation / cellular response to calcium ion / central nervous system myelination / cerebellum development / epithelial cell proliferation / G protein-coupled dopamine receptor signaling pathway / glutamate receptor signaling pathway / learning or memory / membrane protein ectodomain proteolysis / membrane protein intracellular domain proteolysis / myeloid cell homeostasis / neuron apoptotic process / Notch receptor processing / Notch signaling pathway / positive regulation of amyloid precursor protein biosynthetic process / positive regulation of endopeptidase activity / protein processing / proteolysis / regulation of long-term synaptic potentiation / short-term synaptic potentiation / T cell proliferationComponentsazurophil granule membrane / early endosome / endoplasmic reticulum / endoplasmic reticulum membrane / endosome membrane / extracellular exosome / focal adhesion / gamma-secretase complex / Golgi apparatus / Golgi membrane / lysosomal membrane / melanosome / membrane / plasma membrane / presynaptic membrane / sarcolemma / synaptic vesicle
- General Function
- Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein) (PubMed:10993067, PubMed:12679784, PubMed:25043039, PubMed:26280335, PubMed:30598546, PubMed:30630874). The gamma-secretase complex plays a role in Notch and Wnt signaling cascades and regulation of downstream processes via its role in processing key regulatory proteins, and by regulating cytosolic CTNNB1 levels
- Specific Function
- aspartic endopeptidase activity, intramembrane cleaving
- Pfam Domain Function
- Signal Regions
- 1-33
- Transmembrane Regions
- 670-690
- Cellular Location
- Membrane
- Gene sequence
- Not Available
- Chromosome Location
- 1
- Locus
- 1q23.2
- External Identifiers
Resource Link UniProtKB ID Q92542 UniProtKB Entry Name NICA_HUMAN GeneCard ID NCSTN HGNC ID HGNC:17091 PDB ID(s) 2N7Q, 2N7R, 4UIS, 5A63, 5FN2, 5FN3, 5FN4, 5FN5, 6IDF, 6IYC, 6LQG, 6LR4, 7C9I, 7D8X, 7Y5T, 7Y5X, 7Y5Z, 8IM7, 8K8E, 8OQY, 8OQZ, 8X52, 8X53, 8X54 KEGG ID hsa:23385 NCBI Gene ID 23385 - General References
- Not Available
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Esflurbiprofen investigational yes target inhibitor Details Begacestat investigational yes target modulator Details E-2012 investigational yes target modulator Details GSI-136 investigational yes target modulator Details MK-0752 investigational yes target modulator Details Avagacestat investigational yes target modulator Details Itanapraced investigational yes target modulator Details RG-4733 investigational yes target modulator Details Nirogacestat approved, investigational yes target modulator Details Semagacestat investigational yes target modulator Details Tarenflurbil investigational yes target inhibitor Details