Identification

Summary

Olaratumab is a platelet-derived growth factor receptor alpha blocking antibody used with doxorubicin to treat patients with certain types of soft tissue sarcoma (STS).

Brand Names
Lartruvo
Generic Name
Olaratumab
DrugBank Accession Number
DB06043
Background

Olaratumab (IMC-3G3) is a fully human IgG1 monoclonal antibody with antitumor activity that selectively binds the external domain of human platelet-derived growth factor receptor (PDGFR)-α with high affinity and blocks ligand binding. It is composed of two heavy chain molecule fragments and 2 light chain fragments. Studies show that the treatment of olaratumab in combination with doxorubicin resulted in significant reduction of cancer cell proliferation and tumor growth. Olaratumab was granted accelerated approval (as Lartruvo) as initial therapy to treat adults with certain types of soft tissue sarcoma (STS) in October, 2016.

Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Protein Chemical Formula
C6554H10076N1736O2048S40
Protein Average Weight
154000.0 Da (147200 Da without glycan mass/154600 Da with glycan mass)
Sequences
>Heavy Chain
QLQLQESGPGLVKPSETLSLTCTVSGGSINSSSYYWGWLRQSPGKGLEWIGSFFYTGSTY
YNPSLRSRLTISVDTSKNQFSLMLSSVTAADTAVYYCARQSTYYYGSGNYYGWFDRWDQG
TLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTF
PAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCP
APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK
PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT
LPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL
TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>Light Chain
EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA
RFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPPAFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
Synonyms
  • Olaratumab
External IDs
  • IMC-3G3

Pharmacology

Indication

Olaratumab is indicated, in combination with doxorubicin, for the treatment of adult patients with advanced or mestastatic soft tissue sarcoma (STS) with a histologic subtype for which an anthracycline-containing regimen is appropriate and which is not amenable to curative treatment with radiotherapy or surgery.

Reduce drug development failure rates
Build, train, & validate machine-learning models
with evidence-based and structured datasets.
See how
Build, train, & validate predictive machine-learning models with structured datasets.
See how
Associated Conditions
Contraindications & Blackbox Warnings
Avoid life-threatening adverse drug events
Improve clinical decision support with information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.
Learn more
Avoid life-threatening adverse drug events & improve clinical decision support.
Learn more
Pharmacodynamics

It exerts an anti-tumor activity in vivo and in vitro against selected sarcoma cells by inhibiting tumor growth by binding to PDGFR-alpha that is present on several types of cancer on transformed cells and in tumor stroma 3. Olaratumab antibody binding leads to inhibition of ligand-dependent signaling in PDGFR(alpha)-expressing tumor cells, as well as stromal cells in the tumor microenviroment that are dependent on PDGFR(alpha) signaling. When used in a combination therapy with doxorubicin, olaratumab improves progression-free survival in patients with advanced soft-tissue sarcoma.

Mechanism of action

Olaratumab blocks ligand-induced tumor cell proliferation, and inhibits receptor autophosphorylation and ligand-induced phosphorylation of the downstream signaling molecules protein kinase B (Akt) and mitogen-activated protein kinase 5. PDGFR signalling is a type of tyrosine kinase-mediated pathway that normally regulates cell growth, chemotaxis, and mesenchymal stem cell differentiation. It also promotes internalization of PDGFR thus alters the surface levels of PDGFR.

TargetActionsOrganism
APlatelet-derived growth factor receptor alpha
antagonist
Humans
Absorption

Not Available

Volume of distribution

7.7 L at steady state.

Protein binding

None

Metabolism

Mainly degraded nonspecifically by proteolytic enzymes

Route of elimination

Not Available

Half-life

Estimated value of 11 days

Clearance

Mean value of 0.56L/day

Adverse Effects
Improve decision support & research outcomes
With structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates.
Learn more
Improve decision support & research outcomes with our structured adverse effects data.
Learn more
Toxicity

Infusion-related reactions may occur during or after the administration which include bronchospasm, flushing, hypotension, anaphylactic shock, or cardiac arrest. Olaratumab may cause embryo-fetal toxicity based on animal data and its mechanism of action. Other reported adverse effects include neutropenia, leukopenia, anemia, nausea and musculoskeletal pain.

Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Olaratumab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Olaratumab.
AducanumabThe risk or severity of adverse effects can be increased when Olaratumab is combined with Aducanumab.
AlemtuzumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Olaratumab.
AlirocumabThe risk or severity of adverse effects can be increased when Olaratumab is combined with Alirocumab.
AmivantamabThe risk or severity of adverse effects can be increased when Olaratumab is combined with Amivantamab.
AnifrolumabThe risk or severity of adverse effects can be increased when Olaratumab is combined with Anifrolumab.
AnsuvimabThe risk or severity of adverse effects can be increased when Olaratumab is combined with Ansuvimab.
Anthrax immune globulin humanThe risk or severity of adverse effects can be increased when Olaratumab is combined with Anthrax immune globulin human.
Antilymphocyte immunoglobulin (horse)The risk or severity of adverse effects can be increased when Olaratumab is combined with Antilymphocyte immunoglobulin (horse).
Identify potential medication risks
Easily compare up to 40 drugs with our drug interaction checker.
Get severity rating, description, and management advice.
Learn more
Food Interactions
No interactions found.

Products

Drug product information from 10+ global regions
Our datasets provide approved product information including:
dosage, form, labeller, route of administration, and marketing period.
Access now
Access drug product information from over 10 global regions.
Access now
Brand Name Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing EndRegionImage
LartruvoSolution190 mg / 19 mLIntravenousEli Lilly & Co. Ltd.2020-06-092020-09-25Canada flag
LartruvoInjection, solution10 mg/1mLIntravenousEli Lilly and Company2016-10-19Not applicableUS flag
LartruvoInjection, solution, concentrate10 mg/mlIntravenousEli Lilly Nederland B.V.2020-12-162019-09-02EU flag
LartruvoSolution500 mg / 50 mLIntravenousEli Lilly & Co. Ltd.2017-12-222020-06-19Canada flag
LartruvoInjection, solution, concentrate10 mg/mlIntravenousEli Lilly Nederland B.V.2020-12-162019-09-02EU flag
LartruvoInjection, solution10 mg/1mLIntravenousEli Lilly and Company2016-10-19Not applicableUS flag
LartruvoInjection, solution, concentrate10 mg/mlIntravenousEli Lilly Nederland B.V.2020-12-162019-09-02EU flag

Categories

ATC Codes
L01XC27 — Olaratumab
Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available
Affected organisms
  • Humans and other mammals

Chemical Identifiers

UNII
TT6HN20MVF
CAS number
1024603-93-7

References

General References
  1. Dolloff NG, Russell MR, Loizos N, Fatatis A: Human bone marrow activates the Akt pathway in metastatic prostate cells through transactivation of the alpha-platelet-derived growth factor receptor. Cancer Res. 2007 Jan 15;67(2):555-62. [Article]
  2. Shirley M: Olaratumab: First Global Approval. Drugs. 2016 Dec 19. [Article]
  3. Doi T, Ma Y, Dontabhaktuni A, Nippgen C, Nippgen J, Ohtsu A: Phase I study of olaratumab in Japanese patients with advanced solid tumors. Cancer Sci. 2014 Jul;105(7):862-9. doi: 10.1111/cas.12444. Epub 2014 Jun 27. [Article]
  4. Knepper TC, Saller J, Walko CM: Novel and Expanded Oncology Drug Approvals of 2016-PART 1: New Options in Solid Tumor Management. Oncology (Williston Park). 2017 Feb 15;31(2):110-21. [Article]
  5. Wagner AJ, Kindler H, Gelderblom H, Schoffski P, Bauer S, Hohenberger P, Kopp HG, Lopez-Martin JA, Peeters M, Reichardt P, Qin A, Nippgen J, Ilaria RL, Rutkowski P: A phase II study of a human anti-PDGFRalpha monoclonal antibody (olaratumab, IMC-3G3) in previously treated patients with metastatic gastrointestinal stromal tumors. Ann Oncol. 2017 Mar 1;28(3):541-546. doi: 10.1093/annonc/mdw659. [Article]
  6. Tap WD, Jones RL, Van Tine BA, Chmielowski B, Elias AD, Adkins D, Agulnik M, Cooney MM, Livingston MB, Pennock G, Hameed MR, Shah GD, Qin A, Shahir A, Cronier DM, Ilaria R Jr, Conti I, Cosaert J, Schwartz GK: Olaratumab and doxorubicin versus doxorubicin alone for treatment of soft-tissue sarcoma: an open-label phase 1b and randomised phase 2 trial. Lancet. 2016 Jul 30;388(10043):488-97. doi: 10.1016/S0140-6736(16)30587-6. Epub 2016 Jun 9. [Article]
KEGG Drug
D09939
PubChem Substance
347910322
RxNav
1855735
ChEMBL
CHEMBL1743049
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Olaratumab
FDA label
Download (355 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
3Active Not RecruitingTreatmentSoft Tissue Sarcoma (STS)1
2CompletedTreatmentGlioblastoma Multiforme, Adult1
2CompletedTreatmentNeoplasms, Ovarian1
2CompletedTreatmentNon-Small Cell Lung Carcinoma (NSCLC)1
2CompletedTreatmentProstate Cancer1
2TerminatedTreatmentAdvanced Soft Tissue Sarcoma (STS)1
2TerminatedTreatmentGastrointestinal Stromal Tumor (GIST)1
1Active Not RecruitingTreatmentSoft Tissue Sarcoma (STS)2
1CompletedNot AvailableSolid Tumors1
1CompletedBasic ScienceSoft Tissue Sarcoma (STS)1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage Forms
FormRouteStrength
Injection, solutionIntravenous10 mg/1mL
Injection, solution, concentrateIntravenous10 mg/ml
Injection, solution, concentrateIntravenous; Parenteral10 MG/ML
SolutionIntravenous190 mg / 19 mL
SolutionIntravenous500 mg / 50 mL
Prices
Not Available
Patents
Not Available

Properties

State
Liquid
Experimental Properties
Not Available

Targets

Build, predict & validate machine-learning models
Use our structured and evidence-based datasets to unlock new
insights and accelerate drug research.
Learn more
Use our structured and evidence-based datasets to unlock new insights and accelerate drug research.
Learn more
Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Antagonist
General Function
Vascular endothelial growth factor-activated receptor activity
Specific Function
Tyrosine-protein kinase that acts as a cell-surface receptor for PDGFA, PDGFB and PDGFC and plays an essential role in the regulation of embryonic development, cell proliferation, survival and chem...
Gene Name
PDGFRA
Uniprot ID
P16234
Uniprot Name
Platelet-derived growth factor receptor alpha
Molecular Weight
122668.46 Da
References
  1. van der Graaf WT: Olaratumab in soft-tissue sarcomas. Lancet. 2016 Jul 30;388(10043):442-4. doi: 10.1016/S0140-6736(16)30788-7. Epub 2016 Jun 9. [Article]
  2. Doi T, Ma Y, Dontabhaktuni A, Nippgen C, Nippgen J, Ohtsu A: Phase I study of olaratumab in Japanese patients with advanced solid tumors. Cancer Sci. 2014 Jul;105(7):862-9. doi: 10.1111/cas.12444. Epub 2014 Jun 27. [Article]

Drug created at November 18, 2007 18:29 / Updated at August 07, 2022 05:31