Von Willebrand Factor Human

Identification

Name
Von Willebrand Factor Human
Accession Number
DB13133
Description

von Willebrand Factor (vWF) is a multimeric glycoprotein that consists of disulfide-bridge linked dimers. It is usually circulating in plasma as a stable complex with the coagulation factor VIII. The human vWF, as a drug product, is a complex that also contains the coagulation factor VIII.1 This complex was developed by Octapharma Pharmazeutika Produktionsges and FDA approved on August 21, 2015.8

Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Other protein based therapies
Protein Structure
Db13133
Protein Chemical Formula
Not Available
Protein Average Weight
20000000.0 Da (All multimers included)
Sequences
>von Willebrand factor<<<
MIPARFAGVLLALALILPGTLCAEGTRGRSSTARCSLFGSDFVNTFDGSMYSFAGYCSYL
AGGCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYLE
TEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTLT
SDPYDFANSWALSSGEQWCERASPPSSSCNISSGEMQKGLWEQCQLLKSTSVFARCHPLV
DPEPFVALCEKTLCECAGGLECACPALLEYARTCAQEGMVLYGWTDHSACSPVCPAGMEY
RQCVSPCARTCQSLHINEMCQERCVDGCSCPEGQLLDEGLCVESTECPCVHSGKRYPPGT
SLSRDCNTCICRNSQWICSNEECPGECLVTGQSHFKSFDNRYFTFSGICQYLLARDCQDH
SFSIVIETVQCADDRDAVCTRSVTVRLPGLHNSLVKLKHGAGVAMDGQDIQLPLLKGDLR
IQHTVTASVRLSYGEDLQMDWDGRGRLLVKLSPVYAGKTCGLCGNYNGNQGDDFLTPSGL
AEPRVEDFGNAWKLHGDCQDLQKQHSDPCALNPRMTRFSEEACAVLTSPTFEACHRAVSP
LPYLRNCRYDVCSCSDGRECLCGALASYAAACAGRGVRVAWREPGRCELNCPKGQVYLQC
GTPCNLTCRSLSYPDEECNEACLEGCFCPPGLYMDERGDCVPKAQCPCYYDGEIFQPEDI
FSDHHTMCYCEDGFMHCTMSGVPGSLLPDAVLSSPLSHRSKRSLSCRPPMVKLVCPADNL
RAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGET
VKIGCNTCVCRDRKWNCTDHVCDATCSTIGMAHYLTFDGLKYLFPGECQYVLVQDYCGSN
PGTFRILVGNKGCSHPSVKCKKRVTILVEGGEIELFDGEVNVKRPMKDETHFEVVESGRY
IILLLGKALSVVWDRHLSISVVLKQTYQEKVCGLCGNFDGIQNNDLTSSNLQVEEDPVDF
GNSWKVSSQCADTRKVPLDSSPATCHNNIMKQTMVDSSCRILTSDVFQDCNKLVDPEPYL
DVCIYDTCSCESIGDCACFCDTIAAYAHVCAQHGKVVTWRTATLCPQSCEERNLRENGYE
CEWRYNSCAPACQVTCQHPEPLACPVQCVEGCHAHCPPGKILDELLQTCVDPEDCPVCEV
AGRRFASGKKVTLNPSDPEHCQICHCDVVNLTCEACQEPGGLVVPPTDAPVSPTTLYVED
ISEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEY
HDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIA
LLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLS
SVDELEQQRDEIVSYLCDLAPEAPPPTLPPHMAQVTVGPGLLGVSTLGPKRNSMVLDVAF
VLEGSDKIGEADFNRSKEFMEEVIQRMDVGQDSIHVTVLQYSYMVTVEYPFSEAQSKGDI
LQRVREIRYQGGNRTNTGLALRYLSDHSFLVSQGDREQAPNLVYMVTGNPASDEIKRLPG
DIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQRCCSGEGLQIPTLS
PAPDCSQPLDVILLLDGSSSFPASYFDEMKSFAKAFISKANIGPRLTQVSVLQYGSITTI
DVPWNVVPEKAHLLSLVDVMQREGGPSQIGDALGFAVRYLTSEMHGARPGASKAVVILVT
DVSVDSVDAAADAARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTMV
TLGNSFLHKLCSGFVRICMDEDGNEKRPGDVWTLPDQCHTVTCQPDGQTLLKSHRVNCDR
GLRPSCPNSQSPVKVEETCGCRWTCPCVCTGSSTRHIVTFDGQNFKLTGSCSYVLFQNKE
QDLEVILHNGACSPGARQGCMKSIEVKHSALSVELHSDMEVTVNGRLVSVPYVGGNMEVN
VYGAIMHEVRFNHLGHIFTFTPQNNEFQLQLSPKTFASKTYGLCGICDENGANDFMLRDG
TVTTDWKTLVQEWTVQRPGQTCQPILEEQCLVPDSSHCQVLLLPLFAECHKVLAPATFYA
ICQQDSCHQEQVCEVIASYAHLCRTNGVCVDWRTPDFCAMSCPPSLVYNHCEHGCPRHCD
GNVSSCGDHPSEGCFCPPDKVMLEGSCVPEEACTQCIGEDGVQHQFLEAWVPDHQPCQIC
TCLSGRKVNCTTQPCPTAKAPTCGLCEVARLRQNADQCCPEYECVCDPVSCDLPPVPHCE
RGLQPTLTNPGECRPNFTCACRKEECKRVSPPSCPPHRLPTLRKTQCCDEYECACNCVNS
TVSCPLGYLASTATNDCGCTTTTCLPDKVCVHRSTIYPVGQFWEEGCDVCTCTDMEDAVM
GLRVAQCSQKPCEDSCRSGFTYVLHEGECCGRCLPSACEVVTGSPRGDSQSSWKSVGSQW
ASPENPCLINECVRVKEEVFIQQRNVSCPQLEVPVCPSGFQLSCKTSACCPSCRCERMEA
CMLNGTVIGPGKTVMIDVCTTCRCMVQVGVISGFKLECRKTTCNPCPLGYKEENNTGECC
GRCLPTACTIQLRGGQIMTLKRDETLQDGCDTHFCKVNERGEYFWEKRVTGCPPFDEHKC
LAEGGKIMKIPGTCCDTCEEPECNDITARLQYVKVGSCKSEVEVDIHYCQGKCASKAMYS
IDINDVQDQCSCCSPTRTEPMQVALHCTNGSVVYHEVLNAMECKCSPRKCSK
Download FASTA Format
Synonyms
  • Factor con Willebrand
  • Factor von Willebrand
  • Human von willebrand factor
  • Von willebrand factor
  • Von willebrand factor (human)
  • Von willebrand factor complex (human)
  • von Willebrand factor, human
  • Von willebrand's factor

Pharmacology

Indication

The vWF and Factor VIII complex is indicated for the prevention of excessive bleeding during and after minor and major surgery in adult and pediatric von Willebrand disease patients. It is also indicated for the on-demand treatment and control of bleeding episodes.9 The von Willebrand disease is an inherited disorder characterized by the deficiency or misfunction of the von Willebrand factor (vWF). Due to this deficiency, the blood cannot clot properly and the patients that present this disease are prone to prolonged or excessive bleeding. There are three types of this disease, and type 3 is an autosomal recessive inherited disorder marked by very low or absent levels of vWF.10

Associated Conditions
Contraindications & Blackbox Warnings
Learn about our commercial Contraindications & Blackbox Warnings data.
Learn More
Pharmacodynamics

The efficacy in clinical trials of vWF in surgical procedures is of 96.7% regardless the type of von Willebrand disease.9 In a perioperative setting, the hemostatic effects were rated as excellent in a dose of 848.6 IU/kg and no anti-factor VII or inhibitors were detected.2 These excellent results come from the re-establishment of platelet-adhesion to the subendothelium at sites of vascular damage and the aggregation of platelets. vWF allows the protection of factor VIII from the rapid degradation and thus it restores normal coagulation.9

Mechanism of action

The vWF is involved in primary and secondary homeostasis and it is also a carrier and stabilizing protein that protects the coagulation factor VIII from proteolysis and clearance.1 vWF also presents an adhesive function in which it mediates the binding between platelets and subendothelial tissues.4 The external human vWF acts as the endogenous vWF and thus, it presents all the functions abovementioned.9

TargetActionsOrganism
ACoagulation factor VIII
stabilization
Humans
ACollagen alpha-1(I) chain
binder
Humans
Absorption

According to clinical trials in patients with von Willebrand disease, the AUC, Cmax and mean residence time was approximately 1119 h.IU/dL, 76 IU/dL and 20.6 hours, respectively.2

Volume of distribution

The volume of distribution of the human concentrate vWF is 69.7 ml/kg.2

Protein binding

Vonicog alfa presents a very high plasma protein binding as its main function is performed in the blood.6

Metabolism

The endogenous regulator of the vWF is ADAMTS13. The interaction between these two proteins results in the proteolysis of vWF. This proteolysis occurs primarily in the cleavage site at the domain A2 which is a target domain for ADAMTS13.7

Route of elimination

The majority of vWF is targeted to the liver and spleen which indicates an active regulatory elimination mechanism. It seems to be uptaken mainly by macrophages.5

Half-life

The reported terminal half-life of the concentrate of vWF and factor VIII is of 15.8 hours.3

Clearance

The clearance rate of the human concentrate vWF is 3.9 ml.h/kg.2

Adverse Effects
Learn about our commercial Adverse Effects data.
Learn More
Toxicity

The administration of human vWF seems to be very well accepted.

Affected organisms
  • Humans
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
AbciximabThe therapeutic efficacy of Von Willebrand Factor Human can be decreased when used in combination with Abciximab.
AcenocoumarolThe therapeutic efficacy of Von Willebrand Factor Human can be decreased when used in combination with Acenocoumarol.
Acetylsalicylic acidThe therapeutic efficacy of Von Willebrand Factor Human can be decreased when used in combination with Acetylsalicylic acid.
Alpha-1-proteinase inhibitorAlpha-1-proteinase inhibitor may increase the thrombogenic activities of Von Willebrand Factor Human.
AlteplaseThe therapeutic efficacy of Von Willebrand Factor Human can be decreased when used in combination with Alteplase.
Aminocaproic acidThe risk or severity of adverse effects can be increased when Aminocaproic acid is combined with Von Willebrand Factor Human.
AncrodThe therapeutic efficacy of Von Willebrand Factor Human can be decreased when used in combination with Ancrod.
AnistreplaseThe therapeutic efficacy of Von Willebrand Factor Human can be decreased when used in combination with Anistreplase.
Antithrombin AlfaThe therapeutic efficacy of Von Willebrand Factor Human can be decreased when used in combination with Antithrombin Alfa.
Antithrombin III humanThe therapeutic efficacy of Von Willebrand Factor Human can be decreased when used in combination with Antithrombin III human.
Additional Data Available
  • Extended Description
    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
Not Available

Products

Brand Name Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing EndRegionImage
VonvendiKit1300 [iU]/10mLIntravenousBaxalta US Inc.2015-12-08Not applicableUS flag
VonvendiKit650 [iU]/5mLIntravenousBaxalta US Inc.2015-12-08Not applicableUS flag
Additional Data Available
  • Application Number
    Application Number

    A unique ID assigned by the FDA when a product is submitted for approval by the labeller.

    Learn more
  • Product Code
    Product Code

    A governmentally-recognized ID which uniquely identifies the product within its regulatory market.

    Learn more
Mixture Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing EndRegionImage
AlphanateVon Willebrand Factor Human (600 unit) + Antihemophilic factor human (500 unit)Powder, for solutionIntravenousGrifols Biologicals LlcNot applicableNot applicableCanada flag
AlphanateVon Willebrand Factor Human (1800 unit) + Antihemophilic factor human (1500 unit)Powder, for solutionIntravenousGrifols Biologicals LlcNot applicableNot applicableCanada flag
AlphanateVon Willebrand Factor Human (300 unit) + Antihemophilic factor human (250 unit)Powder, for solutionIntravenousGrifols Biologicals LlcNot applicableNot applicableCanada flag
AlphanateVon Willebrand Factor Human (1200 unit) + Antihemophilic factor human (1000 unit)Powder, for solutionIntravenousGrifols Biologicals LlcNot applicableNot applicableCanada flag
AlphanateVon Willebrand Factor Human (2400 unit) + Antihemophilic factor human (2000 unit)Powder, for solutionIntravenousGrifols Biologicals LlcNot applicableNot applicableCanada flag
Humate-PVon Willebrand Factor Human (1680 unit) + Antihemophilic factor human (600 unit)Powder, for solutionIntravenousCsl Behring2004-12-06Not applicableCanada flag
Humate-PVon Willebrand Factor Human (840 unit) + Antihemophilic factor human (300 unit)Powder, for solutionIntravenousCsl Behring2004-12-06Not applicableCanada flag
Humate-PVon Willebrand Factor Human (3360 unit) + Antihemophilic factor human (1200 unit)Powder, for solutionIntravenousCsl Behring2004-12-06Not applicableCanada flag
von Willebrand Factor/Coagulation Factor VIII Complex (Human)Von Willebrand Factor Human (900 [iU]/10mL) + Von Willebrand Factor Human (450 [iU]/5mL) + Antihemophilic factor human (900 [iU]/10mL) + Antihemophilic factor human (450 [iU]/5mL)Powder, for solutionIntravenousOctapharma Pharmazeutika Produktionsgesellschaft M.B.H.2009-12-042009-12-29US flag
von Willebrand Factor/Coagulation Factor VIII Complex (Human)Von Willebrand Factor Human (900 [iU]/10mL) + Von Willebrand Factor Human (450 [iU]/5mL) + Antihemophilic factor human (900 [iU]/10mL) + Antihemophilic factor human (450 [iU]/5mL)Powder, for solutionIntravenousOctapharma Pharmazeutika Produktionsgesellschaft M.B.H.2009-12-042009-12-29US flag

Categories

ATC Codes
B02BD06 — Von willebrand factor and coagulation factor viii in combinationB02BD10 — Von willebrand factor
Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Chemical Identifiers

UNII
ZE22NE22F1
CAS number
109319-16-6

References

General References
  1. Clifton JG, Huang F, Kovac S, Yang X, Hixson DC, Josic D: Proteomic characterization of plasma-derived clotting factor VIII-von Willebrand factor concentrates. Electrophoresis. 2009 Oct;30(20):3636-46. doi: 10.1002/elps.200900270. [PubMed:19768705]
  2. Klukowska A, Windyga J, Batorova A: Clinical efficacy of a novel VWF-containing FVIII concentrate, Wilate((R)), in the prophylaxis and treatment of bleeding episodes in previously treated haemophilia A patients. Thromb Res. 2011 Mar;127(3):247-53. doi: 10.1016/j.thromres.2010.11.030. Epub 2011 Jan 8. [PubMed:21220152]
  3. Kessler CM, Friedman K, Schwartz BA, Gill JC, Powell JS: The pharmacokinetic diversity of two von Willebrand factor (VWF)/ factor VIII (FVIII) concentrates in subjects with congenital von Willebrand disease. Results from a prospective, randomised crossover study. Thromb Haemost. 2011 Aug;106(2):279-88. doi: 10.1160/TH11-02-0057. Epub 2011 Jul 4. [PubMed:21725579]
  4. Reininger AJ, Heijnen HF, Schumann H, Specht HM, Schramm W, Ruggeri ZM: Mechanism of platelet adhesion to von Willebrand factor and microparticle formation under high shear stress. Blood. 2006 May 1;107(9):3537-45. doi: 10.1182/blood-2005-02-0618. Epub 2006 Jan 31. [PubMed:16449527]
  5. Lenting PJ, Christophe OD, Denis CV: von Willebrand factor biosynthesis, secretion, and clearance: connecting the far ends. Blood. 2015 Mar 26;125(13):2019-28. doi: 10.1182/blood-2014-06-528406. Epub 2015 Feb 23. [PubMed:25712991]
  6. Gill JC, Castaman G, Windyga J, Kouides P, Ragni M, Leebeek FW, Obermann-Slupetzky O, Chapman M, Fritsch S, Pavlova BG, Presch I, Ewenstein B: Hemostatic efficacy, safety, and pharmacokinetics of a recombinant von Willebrand factor in severe von Willebrand disease. Blood. 2015 Oct 22;126(17):2038-46. doi: 10.1182/blood-2015-02-629873. Epub 2015 Aug 3. [PubMed:26239086]
  7. Chung MC, Popova TG, Jorgensen SC, Dong L, Chandhoke V, Bailey CL, Popov SG: Degradation of circulating von Willebrand factor and its regulator ADAMTS13 implicates secreted Bacillus anthracis metalloproteases in anthrax consumptive coagulopathy. J Biol Chem. 2008 Apr 11;283(15):9531-42. doi: 10.1074/jbc.M705871200. Epub 2008 Feb 8. [PubMed:18263586]
  8. FDA Records [Link]
  9. Octapharma [Link]
  10. National Institute for Health Research [Link]
PubChem Substance
347911428
RxNav
826072
FDA label
Download (367 KB)
MSDS
Download (27 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
4CompletedTreatmentVon Willebrand's Disease1
4Not Yet RecruitingTreatmentBleeding1
4TerminatedTreatmentHemophilia A1
4TerminatedTreatmentHemophilia A / Hemophilia A With Inhibitors1
3Active Not RecruitingPreventionVon Willebrand's Disease1
3CompletedNot AvailableHemophilia A1
3CompletedTreatmentHemophilia A2
3CompletedTreatmentSevere Hemophilia A2
3CompletedTreatmentVon Willebrand's Disease2
3Not Yet RecruitingPreventionPostpartum Haemorrhage (PPH) / Von Willebrand Diseases1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage Forms
FormRouteStrength
Injection, powder, lyophilized, for solutionParenteral1200 IU
Injection, powder, lyophilized, for solutionParenteral1800 IU
Injection, powder, lyophilized, for solutionParenteral300 IU
Injection, powder, lyophilized, for solutionParenteral600 IU
Injection, powder, lyophilized, for solutionIntravenous1000 IU/10mL
Injection, powder, lyophilized, for solutionIntravenous1500 IU/15mL
Injection, powder, lyophilized, for solutionIntravenous250 IU/10mL
Injection, powder, lyophilized, for solutionIntravenous500 IU/10mL
Injection, powder, lyophilized, for solutionIntravenous300 IU
Injection, powder, lyophilized, for solutionIntravenous1800 IU
Injection, powder, lyophilized, for solutionIntravenous1000 IU
Powder, for solutionParenteral1000 UI
Powder, for solutionParenteral500 UI
InjectionIntravenous1000 iu
InjectionIntravenous500 iu
Injection, powder, for solutionIntravenous500 iu
Injection, powder, for solutionParenteral1000 UI
Injection, powder, for solutionParenteral250 UI
Injection, powder, for solutionParenteral500 UI
Injection, powder, for solutionIntravenous1000 UI/2400UI
Injection, powder, for solutionIntravenous250 UI/600UI
Injection, powder, for solutionIntravenous500 UI/1200UI
PowderIntravenous2400 IU
Injection, powder, lyophilized, for solutionIntravenous600 IU
PowderIntravenous500 IU
Injection, powder, lyophilized, for solutionIntravenous500 IU
KitIntravenous1300 [iU]/10mL
KitIntravenous650 [iU]/5mL
Injection, powder, lyophilized, for solutionParenteral1000 IU
Injection, powder, lyophilized, for solutionParenteral400 IU
Injection, powder, lyophilized, for solutionParenteral500 IU
Injection, powder, lyophilized, for solutionParenteral800 IU
Powder, for solutionIntravenous
Injection, powder, for solutionIntravenous100 UI/ML
Injection, powder, for solutionParenteral1000 I.E.
Injection, powder, for solutionParenteral2000 I.E.
Injection, powder, for solutionParenteral500 I.E.
Prices
Not Available
Patents
Not Available

Properties

State
Solid
Experimental Properties
PropertyValueSource
isoelectric point5.7-5.9Fulcher, et al. Blood. (1983).

Targets

Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Stabilization
General Function
Oxidoreductase activity
Specific Function
Factor VIII, along with calcium and phospholipid, acts as a cofactor for factor IXa when it converts factor X to the activated form, factor Xa.
Gene Name
F8
Uniprot ID
P00451
Uniprot Name
Coagulation factor VIII
Molecular Weight
267007.42 Da
References
  1. Brown R: Recombinant von Willebrand factor for severe gastrointestinal bleeding unresponsive to other treatments in a patient with type 2A von Willebrand disease: a case report. Blood Coagul Fibrinolysis. 2017 Oct;28(7):570-575. doi: 10.1097/MBC.0000000000000632. [PubMed:28379876]
  2. Gill JC, Castaman G, Windyga J, Kouides P, Ragni M, Leebeek FW, Obermann-Slupetzky O, Chapman M, Fritsch S, Pavlova BG, Presch I, Ewenstein B: Hemostatic efficacy, safety, and pharmacokinetics of a recombinant von Willebrand factor in severe von Willebrand disease. Blood. 2015 Oct 22;126(17):2038-46. doi: 10.1182/blood-2015-02-629873. Epub 2015 Aug 3. [PubMed:26239086]
Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Binder
General Function
Platelet-derived growth factor binding
Specific Function
Type I collagen is a member of group I collagen (fibrillar forming collagen).
Gene Name
COL1A1
Uniprot ID
P02452
Uniprot Name
Collagen alpha-1(I) chain
Molecular Weight
138941.105 Da
References
  1. Brown R: Recombinant von Willebrand factor for severe gastrointestinal bleeding unresponsive to other treatments in a patient with type 2A von Willebrand disease: a case report. Blood Coagul Fibrinolysis. 2017 Oct;28(7):570-575. doi: 10.1097/MBC.0000000000000632. [PubMed:28379876]
  2. Gill JC, Castaman G, Windyga J, Kouides P, Ragni M, Leebeek FW, Obermann-Slupetzky O, Chapman M, Fritsch S, Pavlova BG, Presch I, Ewenstein B: Hemostatic efficacy, safety, and pharmacokinetics of a recombinant von Willebrand factor in severe von Willebrand disease. Blood. 2015 Oct 22;126(17):2038-46. doi: 10.1182/blood-2015-02-629873. Epub 2015 Aug 3. [PubMed:26239086]

Enzymes

Kind
Protein
Organism
Humans
Pharmacological action
No
Actions
Substrate
General Function
Cleaves the vWF multimers in plasma into smaller forms thereby controlling vWF-mediated platelet thrombus formation.
Specific Function
Calcium ion binding
Gene Name
ADAMTS13
Uniprot ID
Q76LX8
Uniprot Name
A disintegrin and metalloproteinase with thrombospondin motifs 13
Molecular Weight
153603.05 Da
References
  1. Chung MC, Popova TG, Jorgensen SC, Dong L, Chandhoke V, Bailey CL, Popov SG: Degradation of circulating von Willebrand factor and its regulator ADAMTS13 implicates secreted Bacillus anthracis metalloproteases in anthrax consumptive coagulopathy. J Biol Chem. 2008 Apr 11;283(15):9531-42. doi: 10.1074/jbc.M705871200. Epub 2008 Feb 8. [PubMed:18263586]

Drug created on October 20, 2016 21:34 / Updated on June 12, 2020 10:53

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Logo pink
Stay in the know!
As part of our commitment to providing the most up-to-date drug information, we will be releasing #DrugBankUpdates with our newly added curated drug pages.
#DrugBankUpdates