Aldo-keto reductase family 1 member B10

Details

Name
Aldo-keto reductase family 1 member B10
Synonyms
  • 1.1.1.-
  • AKR1B11
  • Aldose reductase-like
  • Aldose reductase-related protein
  • ARL-1
  • ARP
  • hARP
  • SI reductase
  • Small intestine reductase
Gene Name
AKR1B10
Organism
Humans
Amino acid sequence
>lcl|BSEQ0017418|Aldo-keto reductase family 1 member B10
MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQ
EKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGD
DLFPKDDKGNAIGGKATFLDAWEAMEELVDEGLVKALGVSNFSHFQIEKLLNKPGLKYKP
VTNQVECHPYLTQEKLIQYCHSKGITVTAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAK
HKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFKLSDEEMATILSFNRNWRACN
VLQSSHLEDYPFNAEY
Number of residues
316
Molecular Weight
36019.295
Theoretical pI
7.63
GO Classification
Functions
aldo-keto reductase (NADP) activity / geranylgeranyl reductase activity / indanol dehydrogenase activity / retinal dehydrogenase activity
Processes
cellular aldehyde metabolic process / daunorubicin metabolic process / digestion / doxorubicin metabolic process / farnesol catabolic process / phototransduction, visible light / retinoid metabolic process / steroid metabolic process
Components
cytosol / extracellular exosome / lysosome
General Function
Retinal dehydrogenase activity
Specific Function
Acts as all-trans-retinaldehyde reductase. Can efficiently reduce aliphatic and aromatic aldehydes, and is less active on hexoses (in vitro). May be responsible for detoxification of reactive aldehydes in the digested food before the nutrients are passed on to other organs.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Lysosome
Gene sequence
>lcl|BSEQ0017419|Aldo-keto reductase family 1 member B10 (AKR1B10)
ATGGCCACGTTTGTGGAGCTCAGTACCAAAGCCAAGATGCCCATTGTGGGCCTGGGCACT
TGGAAGTCTCCTCTTGGCAAAGTGAAAGAAGCAGTGAAGGTGGCCATTGATGCAGGATAT
CGGCACATTGACTGTGCCTATGTCTATCAGAATGAACATGAAGTGGGGGAAGCCATCCAA
GAGAAGATCCAAGAGAAGGCTGTGAAGCGGGAGGACCTGTTCATCGTCAGCAAGTTGTGG
CCCACTTTCTTTGAGAGACCCCTTGTGAGGAAAGCCTTTGAGAAGACCCTCAAGGACCTG
AAGCTGAGCTATCTGGACGTCTATCTTATTCACTGGCCACAGGGATTCAAGTCTGGGGAT
GACCTTTTCCCCAAAGATGATAAAGGTAATGCCATCGGTGGAAAAGCAACGTTCTTGGAT
GCCTGGGAGGCCATGGAGGAGCTGGTGGATGAGGGGCTGGTGAAAGCCCTTGGGGTCTCC
AATTTCAGCCACTTCCAGATCGAGAAGCTCTTGAACAAACCTGGACTGAAATATAAACCA
GTGACTAACCAGGTTGAGTGTCACCCATACCTCACACAGGAGAAACTGATCCAGTACTGC
CACTCCAAGGGCATCACCGTTACGGCCTACAGCCCCCTGGGCTCTCCGGATAGACCTTGG
GCCAAGCCAGAAGACCCTTCCCTGCTGGAGGATCCCAAGATTAAGGAGATTGCTGCAAAG
CACAAAAAAACCGCAGCCCAGGTTCTGATCCGTTTCCATATCCAGAGGAATGTGATTGTC
ATCCCCAAGTCTGTGACACCAGCACGCATTGTTGAGAACATTCAGGTCTTTGACTTTAAA
TTGAGTGATGAGGAGATGGCAACCATACTCAGCTTCAACAGAAACTGGAGGGCCTGTAAC
GTGTTGCAATCCTCTCATTTGGAAGACTATCCCTTCAATGCAGAATATTGA
Chromosome Location
7
Locus
7q33
External Identifiers
ResourceLink
UniProtKB IDO60218
UniProtKB Entry NameAK1BA_HUMAN
GenBank Protein ID3150035
GenBank Gene IDU37100
HGNC IDHGNC:382
General References
  1. Cao D, Fan ST, Chung SS: Identification and characterization of a novel human aldose reductase-like gene. J Biol Chem. 1998 May 8;273(19):11429-35. [Article]
  2. Hyndman DJ, Flynn TG: Sequence and expression levels in human tissues of a new member of the aldo-keto reductase family. Biochim Biophys Acta. 1998 Aug 20;1399(2-3):198-202. [Article]
  3. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [Article]
  4. Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Dohner H, Dohner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC: Human chromosome 7: DNA sequence and biology. Science. 2003 May 2;300(5620):767-72. Epub 2003 Apr 10. [Article]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  6. Scuric Z, Stain SC, Anderson WF, Hwang JJ: New member of aldose reductase family proteins overexpressed in human hepatocellular carcinoma. Hepatology. 1998 Apr;27(4):943-50. [Article]
  7. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [Article]
  8. Luo DX, Huang MC, Ma J, Gao Z, Liao DF, Cao D: Aldo-keto reductase family 1, member B10 is secreted through a lysosome-mediated non-classical pathway. Biochem J. 2011 Aug 15;438(1):71-80. doi: 10.1042/BJ20110111. [Article]
  9. Gallego O, Ruiz FX, Ardevol A, Dominguez M, Alvarez R, de Lera AR, Rovira C, Farres J, Fita I, Pares X: Structural basis for the high all-trans-retinaldehyde reductase activity of the tumor marker AKR1B10. Proc Natl Acad Sci U S A. 2007 Dec 26;104(52):20764-9. Epub 2007 Dec 17. [Article]
  10. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03461Nicotinamide adenine dinucleotide phosphateexperimentalunknownDetails
DB02383TolrestatwithdrawnunknownDetails
DB08772ZopolrestatexperimentalunknownDetails
DB02021FidarestatexperimentalunknowninhibitorDetails
DB00605Sulindacapproved, investigationalunknowninhibitorDetails
DB06246ExisulindinvestigationalunknowninhibitorDetails
DB06077Lumateperoneapproved, investigationalunknownDetails
DB06077Lumateperoneapproved, investigationalyesDetails