Myoglobin

Details

Name
Myoglobin
Synonyms
Not Available
Gene Name
MB
Organism
Humans
Amino acid sequence
>lcl|BSEQ0013125|Myoglobin
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE
DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKH
PGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Number of residues
154
Molecular Weight
17183.725
Theoretical pI
Not Available
GO Classification
Functions
heme binding / metal ion binding / oxygen binding / oxygen transporter activity
Processes
brown fat cell differentiation / enucleate erythrocyte differentiation / heart development / response to hormone / response to hydrogen peroxide / response to hypoxia / slow-twitch skeletal muscle fiber contraction
Components
extracellular exosome
General Function
Oxygen transporter activity
Specific Function
Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0013126|Myoglobin (MB)
ATGGGGCTCAGCGACGGGGAATGGCAGTTGGTGCTGAACGTCTGGGGGAAGGTGGAGGCT
GACATCCCAGGCCATGGGCAGGAAGTCCTCATCAGGCTCTTTAAGGGTCACCCAGAGACT
CTGGAGAAGTTTGACAAGTTCAAGCACCTGAAGTCAGAGGACGAGATGAAGGCGTCTGAG
GACTTAAAGAAGCATGGTGCCACCGTGCTCACCGCCCTGGGTGGCATCCTTAAGAAGAAG
GGGCATCATGAGGCAGAGATTAAGCCCCTGGCACAGTCGCATGCCACCAAGCACAAGATC
CCCGTGAAGTACCTGGAGTTCATCTCGGAATGCATCATCCAGGTTCTGCAGAGCAAGCAT
CCCGGGGACTTTGGTGCTGATGCCCAGGGGGCCATGAACAAGGCCCTGGAGCTGTTCCGG
AAGGACATGGCCTCCAACTACAAGGAGCTGGGCTTCCAGGGCTAG
Chromosome Location
22
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP02144
UniProtKB Entry NameMYG_HUMAN
HGNC IDHGNC:6915
General References
  1. Weller P, Jeffreys AJ, Wilson V, Blanchetot A: Organization of the human myoglobin gene. EMBO J. 1984 Feb;3(2):439-46. [Article]
  2. Akaboshi E: Cloning of the human myoglobin gene. Gene. 1985;33(3):241-9. [Article]
  3. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [Article]
  4. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [Article]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  6. Herrera AE, Lehmann H: Primary structure of human myoglobin. Nat New Biol. 1971 Aug 4;232(31):149-52. [Article]
  7. Romero Herrera AE, Lehmann H: The myoglobin of primates. I. Hylobates agilis (gibbon). Biochim Biophys Acta. 1971 Dec 28;251(3):482-8. [Article]
  8. Romero Herrera AE, Lehmann H: The myoglobin of primates. II. Pan Troglodytes (chimpanzee). Biochim Biophys Acta. 1972 Aug 31;278(1):62-7. [Article]
  9. Corbett JM, Wheeler CH, Baker CS, Yacoub MH, Dunn MJ: The human myocardial two-dimensional gel protein database: update 1994. Electrophoresis. 1994 Nov;15(11):1459-65. [Article]
  10. Boulton FE, Huntsman RG, Lorkin PA, Lehmann H: Abnormal human myoglobin: 53 (D4) glutamic acid--lysine. Nature. 1969 Aug 23;223(5208):832-3. [Article]
  11. Boulton FE, Huntsman RG, Romero Herrera A, Lorkin PA, Lehmann H: The third variant of human myoglobin showing an unusual amino acid substitution: 138(H16)arginine--tryptophan. Biochim Biophys Acta. 1971 Mar 23;229(3):716-9. [Article]
  12. Boulton FE, Huntsman RG, Romero Herrera AE, Lorkin PA, Lehmann H: A human myoglobin variant 133 (H-10)lysine--asparagine. Biochim Biophys Acta. 1971 Mar 23;229(3):871-6. [Article]
  13. Boulton FE, Huntsman RG, Yawson GI, Romero Herrera AE, Lorkin PA, Lehmann H: The second variant of human myoglobin; 138(H16) arginine leads to glutamine. Br J Haematol. 1971 Jan;20(1):69-74. [Article]
  14. Hubbard SR, Hendrickson WA, Lambright DG, Boxer SG: X-ray crystal structure of a recombinant human myoglobin mutant at 2.8 A resolution. J Mol Biol. 1990 May 20;213(2):215-8. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01710Porphyrin Fe(III)experimentalunknownDetails
DB01826N-Butyl IsocyanideexperimentalunknownDetails
DB02073Biliverdine IX AlphaexperimentalunknownDetails
DB02396MethylethylamineexperimentalunknownDetails
DB02528Tetrazolyl HistidineexperimentalunknownDetails
DB026711-MethylimidazoleexperimentalunknownDetails
DB03366Imidazoleexperimental, investigationalunknownDetails
DB033854-MethylimidazoleexperimentalunknownDetails
DB03399Ethyl IsocyanideexperimentalunknownDetails
DB04050N-Propyl IsocyanideexperimentalunknownDetails
DB02379Beta-D-GlucoseexperimentalunknownDetails
DB04337IsocyanomethaneexperimentalunknownDetails
DB02646NitrosoethaneexperimentalunknownDetails
DB09112Nitrous acidapproved, investigationalunknownoxidizerDetails
DB11588Carbon monoxideapproved, investigationalyesinhibitorDetails