Dihydropteroate synthetase

Details

Name
Dihydropteroate synthetase
Synonyms
  • EC 2.5.1.15
Gene Name
Not Available
Organism
Plasmodium falciparum
Amino acid sequence
>lcl|BSEQ0011694|Dihydropteroate synthetase
IPEYKHNVLNNTIRCLYNKYVSRMKEQYNINIKENNKRIYVLKDRISYLKEKTNIVGILN
VNYDSFSDGGIFVEPKRAVQRMFEMINEGASVIDIGGESAGPFVIPNPKISERDLVVPVL
QLFQKEWNDIKNKIVKCDAKPIISIDTINYNVFKECVDNDLVDILNDISACTNNPEIIKL
LKKKNKFYSVVLMHKRGNPHTMDKLTNYDNLVYDIKNYLEQRLNFLVLNGIPRYRILFDI
GLGFAKKHDQSIKLLQNIHVYDEYPLFIGYSRKRFIAHCMNDQNVVINTQQKLHDEQQNE
NKNIVDKSHNWMFQMNYMRKDKDQLLYQKNICGGLAIASYSYYKKVDLIRVHDVLETKSV
LDVLTKIDQV
Number of residues
370
Molecular Weight
43370.845
Theoretical pI
9.19
GO Classification
Functions
dihydropteroate synthase activity
Processes
folic acid-containing compound biosynthetic process
General Function
Dihydropteroate synthase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0004634|1115 bp
TGATACCCGAATATAAGCATAATGTTTTAAATAATACCATCAGATGTTTATATAACAAAT
ATGTGAGTAGGATGAAAGAACAATATAATATAAATATTAAAGAAAATAATAAAAGGATAT
ATGTATTAAAAGATAGAATTTCTTATTTAAAAGAAAAAACAAATATTGTTGGAATATTAA
ATGTTAATTATGATTCTTTTTCAGATGGAGGTATTTTTGTTGAACCTAAACGTGCTGTTC
AAAGAATGTTTGAAATGATAAATGAAGGTGCTAGTGTTATAGATATAGGTGGAGAATCCG
CTGGTCCTTTTGTTATACCTAATCCAAAAATTAGTGAAAGAGATTTAGTAGTACCTGTAT
TACAATTATTTCAAAAAGAATGGAATGATATAAAAAATAAAATTGTTAAATGTGATGCGA
AACCAATTATAAGTATTGATACAATTAACTATAATGTTTTTAAAGAATGTGTTGATAATG
ATTTAGTTGATATATTAAATGATATTAGTGCTTGTACAAATAATCCAGAAATTATAAAAT
TATTAAAAAAAAAAAACAAATTCTATAGTGTAGTTCTAATGCATAAAAGAGGAAATCCAC
ATACAATGGATAAACTAACAAATTATGATAATCTAGTTTATGATATAAAAAATTATTTAG
AACAAAGATTAAATTTTCTTGTATTAAATGGAATACCTCGTTATAGGATACTATTTGATA
TTGGATTAGGATTTGCGAAGAAACATGATCAATCTATTAAACTCTTACAAAATATACATG
TATATGATGAGTATCCACTTTTTATTGGATATTCAAGAAAAAGATTTATTGCCCATTGCA
TGAATGATCAAAATGTTGTAATAAATACACAACAAAAATTACATGATGAACAACAAAATG
AAAATAAAAATATTGTGGACAAATCACACAATTGGATGTTTCAGATGAATTACATGAGGA
AAGACAAGGATCAACTTTTATATCAAAAAAATATATGTGGTGGATTAGCAATTGCTTCCT
ACAGCTATTATAAAAAGGTAGATCTAATAAGAGTTCATGACGTTTTAGAAACAAAATCGG
TTTTGGATGTTTTAACAAAAATAGACCAAGTGTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ27738
UniProtKB Entry NameQ27738_PLAFA
GenBank Protein ID505177
GenBank Gene IDZ30658
General References
  1. Brooks DR, Wang P, Read M, Watkins WM, Sims PF, Hyde JE: Sequence variation of the hydroxymethyldihydropterin pyrophosphokinase: dihydropteroate synthase gene in lines of the human malaria parasite, Plasmodium falciparum, with differing resistance to sulfadoxine. Eur J Biochem. 1994 Sep 1;224(2):397-405. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00664Sulfametopyrazineapproved, withdrawnyesinhibitorDetails
DB01299Sulfadoxineapproved, investigationalyesDetails
DB01145SulfoxoneapprovedyesinhibitorDetails
DB00359Sulfadiazineapproved, investigational, vet_approvedyesinhibitorDetails
DB08798SulfamoxoleexperimentalyesinhibitorDetails
DB06147Sulfathiazoleapproved, vet_approvedyesinhibitorDetails