Calcium-activated potassium channel subunit beta-4
Details
- Name
- Calcium-activated potassium channel subunit beta-4
- Synonyms
- BK channel subunit beta-4
- BKbeta4
- Calcium-activated potassium channel, subfamily M subunit beta-4
- Charybdotoxin receptor subunit beta-4
- Hbeta4
- K(VCA)beta-4
- Maxi K channel subunit beta-4
- Slo-beta-4
- Gene Name
- KCNMB4
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0013100|Calcium-activated potassium channel subunit beta-4 MAKLRVAYEYTEAEDKSIRLGLFLIISGVVSLFIFGFCWLSPALQDLQATEANCTVLSVQ QIGEVFECTFTCGADCRGTSQYPCVQVYVNNSESNSRALLHSDEHQLLTNPKCSYIPPCK RENQKNLESVMNWQQYWKDEIGSQPFTCYFNQHQRPDDVLLHRTHDEIVLLHCFLWPLVT FVVGVLIVVLTICAKSLAVKAEAMKKRKFS
- Number of residues
- 210
- Molecular Weight
- 23948.465
- Theoretical pI
- 6.75
- GO Classification
- Functionscalcium-activated potassium channel activity / potassium channel regulator activityProcessesaction potential / blood coagulation / detection of calcium ion / neuronal action potential / potassium ion transmembrane transport / potassium ion transport / regulation of neurotransmitter secretion / regulation of vasoconstriction / synaptic transmissionComponentsintegral component of plasma membrane / plasma membrane / voltage-gated potassium channel complex
- General Function
- Potassium channel regulator activity
- Specific Function
- Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Decreases the gating kinetics and calcium sensitivity of the KCNMA1 channel, but with fast deactivation kinetics. May decrease KCNMA1 channel openings at low calcium concentrations but increases channel openings at high calcium concentrations. Makes KCNMA1 channel resistant to 100 nM charybdotoxin (CTX) toxin concentrations.
- Pfam Domain Function
- CaKB (PF03185)
- Transmembrane Regions
- 20-40 168-188
- Cellular Location
- Membrane
- Gene sequence
>lcl|BSEQ0013101|Calcium-activated potassium channel subunit beta-4 (KCNMB4) ATGGCGAAGCTCCGGGTGGCTTACGAGTACACGGAAGCCGAGGACAAGAGCATCCGGCTC GGCTTGTTTCTCATCATCTCCGGCGTCGTGTCGCTCTTCATCTTCGGCTTCTGCTGGCTG AGTCCCGCGCTGCAGGATCTGCAAGCCACGGAGGCCAATTGCACGGTGCTGTCGGTGCAG CAGATCGGCGAGGTGTTCGAGTGCACCTTCACCTGTGGCGCCGACTGCAGGGGCACCTCG CAGTACCCCTGCGTCCAGGTCTACGTGAACAACTCTGAGTCCAACTCTAGGGCGCTGCTG CACAGCGACGAGCACCAGCTCCTGACCAACCCCAAGTGCTCCTATATCCCTCCCTGTAAG AGAGAAAATCAGAAGAATTTGGAAAGTGTCATGAATTGGCAACAGTACTGGAAAGATGAG ATTGGTTCCCAGCCATTTACTTGCTATTTTAATCAACATCAAAGACCAGATGATGTGCTT CTGCATCGCACTCATGATGAGATTGTCCTCCTGCATTGCTTCCTCTGGCCCCTGGTGACA TTTGTGGTGGGCGTTCTCATTGTGGTCCTGACCATCTGTGCCAAGAGCTTGGCGGTCAAG GCGGAAGCCATGAAGAAGCGCAAGTTCTCTTAA
- Chromosome Location
- 12
- Locus
- 12q
- External Identifiers
Resource Link UniProtKB ID Q86W47 UniProtKB Entry Name KCMB4_HUMAN GenBank Protein ID 7799988 GenBank Gene ID AF160967 HGNC ID HGNC:6289 - General References
- Meera P, Wallner M, Toro L: A neuronal beta subunit (KCNMB4) makes the large conductance, voltage- and Ca2+-activated K+ channel resistant to charybdotoxin and iberiotoxin. Proc Natl Acad Sci U S A. 2000 May 9;97(10):5562-7. [Article]
- Behrens R, Nolting A, Reimann F, Schwarz M, Waldschutz R, Pongs O: hKCNMB3 and hKCNMB4, cloning and characterization of two members of the large-conductance calcium-activated potassium channel beta subunit family. FEBS Lett. 2000 May 26;474(1):99-106. [Article]
- Brenner R, Jegla TJ, Wickenden A, Liu Y, Aldrich RW: Cloning and functional characterization of novel large conductance calcium-activated potassium channel beta subunits, hKCNMB3 and hKCNMB4. J Biol Chem. 2000 Mar 3;275(9):6453-61. [Article]
- Weiger TM, Holmqvist MH, Levitan IB, Clark FT, Sprague S, Huang WJ, Ge P, Wang C, Lawson D, Jurman ME, Glucksmann MA, Silos-Santiago I, DiStefano PS, Curtis R: A novel nervous system beta subunit that downregulates human large conductance calcium-dependent potassium channels. J Neurosci. 2000 May 15;20(10):3563-70. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Jin P, Weiger TM, Wu Y, Levitan IB: Phosphorylation-dependent functional coupling of hSlo calcium-dependent potassium channel and its hbeta 4 subunit. J Biol Chem. 2002 Mar 22;277(12):10014-20. Epub 2002 Jan 14. [Article]
- Jin P, Weiger TM, Levitan IB: Reciprocal modulation between the alpha and beta 4 subunits of hSlo calcium-dependent potassium channels. J Biol Chem. 2002 Nov 15;277(46):43724-9. Epub 2002 Sep 9. [Article]
- Orio P, Rojas P, Ferreira G, Latorre R: New disguises for an old channel: MaxiK channel beta-subunits. News Physiol Sci. 2002 Aug;17:156-61. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB00721 Procaine approved, investigational, vet_approved unknown blocker Details DB09089 Trimebutine approved yes inhibitor Details DB01110 Miconazole approved, investigational, vet_approved unknown inhibitor Details DB00867 Ritodrine approved, investigational yes activator Details DB01054 Nitrendipine approved, investigational unknown inhibitor Details