Elotuzumab

Identification

Summary

Elotuzumab is an antineoplastic agent and SLAMF7-directed immunostimulatory antibody used for the treatment of refractory multiple myeloma in combination with other antineoplastic agents.

Brand Names
Empliciti
Generic Name
Elotuzumab
DrugBank Accession Number
DB06317
Background

Elotuzumab is a humanized IgG1 (Immunoglobulin G) monoclonal antibody indicated in combination with lenalidomide and dexamethasone for the treatment of patients with multiple myeloma who have received one to three prior therapies. Elotuzumab targets SLAMF7, also known as Signaling Lymphocytic Activation Molecule Family member 7, a cell surface glycoprotein. Elotuzumab consists of the complementary determining regions (CDR) of the mouse antibody, MuLuc63, grafted onto human IgG1 heavy and kappa light chain frameworks. Elotuzumab is produced in NS0 cells by recombinant DNA technology. Elotuzumab has a theoretical mass of 148.1 kDa for the intact antibody. Elotuzumab was approved on November 30, 2015 by the U.S. Food and Drug Administration. Elotuzumab is marketed under the brand Empliciti™ by Bristol-Myers Squibb.

Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Protein Structure
Db06317
Protein Chemical Formula
C6476H9982N1714O2016S42
Protein Average Weight
148100.0 Da
Sequences
>Elotuzumab heavy chain
EVQLVESGGGLVQPGGSLRLSCAASGFDFSRYWMSWVRQAPGKGLEWIGEINPDSSTINY
APSLKDKFIISRDNAKNSLYLQMNSLRAEDTAVYYCARPDGNYWYFDVWGQGTLVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGP
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ
QGNVFSCSVMHEALHNHYTQKSLSLSPGK
>Elotuzumab light chain
DIQMTQSPSSLSASVGDRVTITCKASQDVGIAVAWYQQKPGKVPKLLIYWASTRHTGVPD
RFSGSGSGTDFTLTISSLQPEDVATYYCQQYSSYPYTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
Synonyms
  • Elotuzumab
  • HuLuc63
  • Immunoglobulin G1, anti-(human protein CS1) (human-mouse HuLuc63 heavy chain), disulfide with human-mouse HuLuc63 kappa-chain, dimer
External IDs
  • BMS-901608
  • PDL 063
  • PDL063

Pharmacology

Indication

Indicated in combination with lenalidomide and dexamethasone for the treatment of patients with multiple myeloma who have received one to three prior therapies.

Pharmacology
Accelerate your drug discovery research with the industry’s only fully connected ADMET dataset, ideal for:
Machine Learning
Data Science
Drug Discovery
Accelerate your drug discovery research with our fully connected ADMET dataset
Learn more
Associated Conditions
Contraindications & Blackbox Warnings
Contraindications
Contraindications & Blackbox Warnings
With our commercial data, access important information on dangerous risks, contraindications, and adverse effects.
Learn more
Our Blackbox Warnings cover Risks, Contraindications, and Adverse Effects
Learn more
Pharmacodynamics

Not Available

Mechanism of action

Elotuzumab is a humanized IgG1 monoclonal antibody that specifically targets the SLAMF7 (Signaling Lymphocytic Activation Molecule Family member 7) protein. SLAMF7 is expressed on myeloma cells independent of cytogenetic abnormalities. SLAMF7 is also expressed on Natural Killer cells, plasma cells, and at lower levels on specific immune cell subsets of differentiated cells within the hematopoietic lineage. Elotuzumab directly activates Natural Killer cells through both the SLAMF7 pathway and Fc receptors. Elotuzumab also targets SLAMF7 on myeloma cells and facilitates the interaction with Natural Killer cells to mediate the killing of myeloma cells through antibody-dependent cellular cytotoxicity (ADCC). In preclinical models, the combination of elotuzumab and lenalidomide resulted in enhanced activation of Natural Killer cells that was greater than the effects of either agent alone and increased anti-tumor activity in vitro and in vivo.

TargetActionsOrganism
ASLAM family member 7
modulator
Humans
Absorption

Not Available

Volume of distribution

Not Available

Protein binding

Not Available

Metabolism
Not Available
Route of elimination

Not Available

Half-life

Not Available

Clearance

The clearance of elotuzumab decreased from a geometric mean (CV%) of 17.5 (21.2%) to 5.8 (31%) mL/day/kg with an increase in dose from 0.5 (i.e., 0.05 times the recommended dosage) to 20 mg/kg (i.e., 2 times the recommended dosage). Based on a population PK model, when elotuzumab is given in combination with lenalidomide and dexamethasone, approximately 97% of the maximum steady-state concentration is predicted to be eliminated with a geometric mean (CV%) of 82.4 (48%) days.

Adverse Effects
Medicalerrors
Reduce medical errors
and improve treatment outcomes with our comprehensive & structured data on drug adverse effects.
Learn more
Reduce medical errors & improve treatment outcomes with our adverse effects data
Learn more
Toxicity

Not Available

Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Elotuzumab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Elotuzumab.
AlemtuzumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Elotuzumab.
AlirocumabThe risk or severity of adverse effects can be increased when Elotuzumab is combined with Alirocumab.
AnsuvimabThe risk or severity of adverse effects can be increased when Elotuzumab is combined with Ansuvimab.
Anthrax immune globulin humanThe risk or severity of adverse effects can be increased when Elotuzumab is combined with Anthrax immune globulin human.
Antilymphocyte immunoglobulin (horse)The risk or severity of adverse effects can be increased when Elotuzumab is combined with Antilymphocyte immunoglobulin (horse).
Antithymocyte immunoglobulin (rabbit)The risk or severity of adverse effects can be increased when Antithymocyte immunoglobulin (rabbit) is combined with Elotuzumab.
Asfotase alfaThe risk or severity of adverse effects can be increased when Elotuzumab is combined with Asfotase alfa.
AtezolizumabThe risk or severity of adverse effects can be increased when Elotuzumab is combined with Atezolizumab.
Interactions
Improve patient outcomes
Build effective decision support tools with the industry’s most comprehensive drug-drug interaction checker.
Learn more
Food Interactions
No interactions found.

Products

Products
Comprehensive & structured drug product info
From application numbers to product codes, connect different identifiers through our commercial datasets.
Learn more
Easily connect various identifiers back to our datasets
Learn more
Brand Name Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing EndRegionImage
ElotuzumabInjection, powder, lyophilized, for solution300 mg/1IntravenousBristol-Myers Squibb Holdings Pharma, Ltd. Liability Company2015-11-302015-11-30US flag
ElotuzumabInjection, powder, lyophilized, for solution300 mg/1IntravenousBristol-Myers Squibb Holdings Pharma, Ltd. Liability Company2015-11-302015-11-30US flag
EmplicitiInjection, powder, for solution400 mgIntravenousBristol Myers Squibb Pharma Eeig2016-09-08Not applicableEU flag
EmplicitiPowder, for solution440 mg / vialIntravenousBristol Myers SquibbNot applicableNot applicableCanada flag
EmplicitiInjection, powder, lyophilized, for solution300 mg/1IntravenousE.R. Squibb & Sons, L.L.C.2015-11-30Not applicableUS flag
EmplicitiInjection, powder, for solution300 mgIntravenousBristol Myers Squibb Pharma Eeig2016-09-08Not applicableEU flag
EmplicitiInjection, powder, lyophilized, for solution400 mg/1IntravenousE.R. Squibb & Sons, L.L.C.2015-11-30Not applicableUS flag
EmplicitiPowder, for solution340 mg / vialIntravenousBristol Myers SquibbNot applicableNot applicableCanada flag

Categories

ATC Codes
L01XC23 — Elotuzumab
Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available
Affected organisms
  • Humans and other mammals

Chemical Identifiers

UNII
1351PE5UGS
CAS number
915296-00-3

References

Synthesis Reference

"Patent Link":https://www.google.com/patents/WO2014055370A1?cl=en

General References
  1. Hsi ED, Steinle R, Balasa B, Szmania S, Draksharapu A, Shum BP, Huseni M, Powers D, Nanisetti A, Zhang Y, Rice AG, van Abbema A, Wong M, Liu G, Zhan F, Dillon M, Chen S, Rhodes S, Fuh F, Tsurushita N, Kumar S, Vexler V, Shaughnessy JD Jr, Barlogie B, van Rhee F, Hussein M, Afar DE, Williams MB: CS1, a potential new therapeutic antibody target for the treatment of multiple myeloma. Clin Cancer Res. 2008 May 1;14(9):2775-84. doi: 10.1158/1078-0432.CCR-07-4246. [Article]
  2. Tai YT, Dillon M, Song W, Leiba M, Li XF, Burger P, Lee AI, Podar K, Hideshima T, Rice AG, van Abbema A, Jesaitis L, Caras I, Law D, Weller E, Xie W, Richardson P, Munshi NC, Mathiot C, Avet-Loiseau H, Afar DE, Anderson KC: Anti-CS1 humanized monoclonal antibody HuLuc63 inhibits myeloma cell adhesion and induces antibody-dependent cellular cytotoxicity in the bone marrow milieu. Blood. 2008 Aug 15;112(4):1329-37. Epub 2007 Sep 28. [Article]
  3. Markham A: Elotuzumab: First Global Approval. Drugs. 2016 Mar;76(3):397-403. doi: 10.1007/s40265-016-0540-0. [Article]
KEGG Drug
D09337
PubChem Substance
347910347
RxNav
1726104
ChEMBL
CHEMBL1743010
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
PDRhealth
PDRhealth Drug Page
Wikipedia
Elotuzumab
AHFS Codes
  • 10:00.00 — Antineoplastic Agents
FDA label
Download (245 KB)
MSDS
Download (381 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
3Active Not RecruitingTreatmentMalignant Lymphomas / Multiple Myeloma (MM)1
3Active Not RecruitingTreatmentMultiple Myeloma (MM)3
3RecruitingTreatmentMultiple Myeloma (MM)1
3RecruitingTreatmentNewly Diagnosed Multiple Myeloma1
3TerminatedBasic ScienceNewly Diagnosed, Previously Untreated Multiple Myeloma1
2Active Not RecruitingSupportive CareMultiple Myeloma (MM)1
2Active Not RecruitingTreatmentHematopoietic Cell Transplantation Recipient / Plasma Cell Myeloma1
2Active Not RecruitingTreatmentMultiple Myeloma (MM)7
2Active Not RecruitingTreatmentMultiple Myeloma in Relapse1
2Active Not RecruitingTreatmentRecurrent Primary Amyloidosis1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage Forms
FormRouteStrength
Injection, powder, lyophilized, for solutionIntravenous300 mg/1
Injection, powder, for solutionIntravenous300 mg
Injection, powder, for solutionIntravenous400 mg
Injection, powder, for solutionIntravenous; Parenteral
Injection, powder, lyophilized, for solutionIntravenous
Injection, powder, lyophilized, for solutionIntravenous400 mg/1
Powder, for solutionIntravenous340 mg / vial
Powder, for solutionIntravenous440 mg / vial
Prices
Not Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)Region
US2014055370No2012-10-012032-10-01US flag

Properties

State
Solid
Experimental Properties
Not Available

Targets

Drugtargets
Accelerate your drug discovery research
with our fully connected ADMET & drug target dataset.
Learn more
Accelerate your drug discovery research with our ADMET & drug target dataset
Learn more
Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Modulator
General Function
Not Available
Specific Function
Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differ...
Gene Name
SLAMF7
Uniprot ID
Q9NQ25
Uniprot Name
SLAM family member 7
Molecular Weight
37420.62 Da
References
  1. Markham A: Elotuzumab: First Global Approval. Drugs. 2016 Mar;76(3):397-403. doi: 10.1007/s40265-016-0540-0. [Article]

Drug created on March 19, 2008 16:24 / Updated on May 14, 2021 11:41