Lexatumumab

This drug entry is a stub and has not been fully annotated. It is scheduled to be annotated soon.

Identification

Name
Lexatumumab
Accession Number
DB06599
Description

Lexatumumab is a fully humanized, high-affinity immunoglobulin G(1 lambda) monoclonal antibody (mAb).

Type
Biotech
Groups
Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Protein Structure
Db06599
Protein Chemical Formula
Not Available
Protein Average Weight
Not Available
Sequences
>8753_H|lexatumumab|Homo sapiens||H-GAMMA-1 (VH(1-121)+CH1(122-219)+HINGE-REGION(220-234)+CH2(235-344)+CH3(345-451))|||||||451||||MW 49117.4|MW 49117.4|
EVQLVQSGGGVERPGGSLRLSCAASGFTFDDYGMSWVRQAPGKGLEWVSGINWNGGSTGY
ADSVKGRVTISRDNAKNSLYLQMNSLRAEDTAVYYCAKILGAGRGWYFDLWGKGTTVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRE
EMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>8753_L|lexatumumab|Homo sapiens||L-LAMBDA (V-LAMBDA(1-108)+C-LAMBDA(109-214))|||||||214||||MW 22699.0|MW 22699.0|
SSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDR
FSGSSSGNTASLTITGAQAEDEADYYCNSRDSSGNHVVFGGGTKLTVLGQPKAAPSVTLF
PPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYL
SLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Download FASTA Format
Synonyms
  • Lexatumumab
External IDs
  • ETR2-ST01
  • HGS-1018
  • HGS-ETR2
  • HGS1018
  • TRAIL-R2

Pharmacology

Indication

Investigated for use/treatment in cancer/tumors (unspecified).

Contraindications & Blackbox Warnings
Learn about our commercial Contraindications & Blackbox Warnings data.
Learn More
Pharmacodynamics
Not Available
Mechanism of action

Lexatumumab agonizes the tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) receptor 2 (TRAIL-R2), triggering the extrinsic apoptotic pathway.

TargetActionsOrganism
UTumor necrosis factor receptor superfamily member 10BNot AvailableHumans
Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half-life
Not Available
Clearance
Not Available
Adverse Effects
Learn about our commercial Adverse Effects data.
Learn More
Toxicity
Not Available
Affected organisms
Not Available
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Lexatumumab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Lexatumumab.
AlemtuzumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Lexatumumab.
AlirocumabThe risk or severity of adverse effects can be increased when Lexatumumab is combined with Alirocumab.
Anthrax immune globulin humanThe risk or severity of adverse effects can be increased when Lexatumumab is combined with Anthrax immune globulin human.
Antilymphocyte immunoglobulin (horse)The risk or severity of adverse effects can be increased when Lexatumumab is combined with Antilymphocyte immunoglobulin (horse).
Antithymocyte immunoglobulin (rabbit)The risk or severity of adverse effects can be increased when Antithymocyte immunoglobulin (rabbit) is combined with Lexatumumab.
Asfotase alfaThe risk or severity of adverse effects can be increased when Lexatumumab is combined with Asfotase alfa.
AtezolizumabThe risk or severity of adverse effects can be increased when Lexatumumab is combined with Atezolizumab.
AvelumabThe risk or severity of adverse effects can be increased when Lexatumumab is combined with Avelumab.
Additional Data Available
  • Extended Description
    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
Not Available

Products

Categories

Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Chemical Identifiers

UNII
967Q0SJD77
CAS number
845816-02-6

References

General References
  1. Maddipatla S, Hernandez-Ilizaliturri FJ, Knight J, Czuczman MS: Augmented antitumor activity against B-cell lymphoma by a combination of monoclonal antibodies targeting TRAIL-R1 and CD20. Clin Cancer Res. 2007 Aug 1;13(15 Pt 1):4556-64. [PubMed:17671142]
  2. Zhang X, Li W, Olumi AF: Low-dose 12-O-tetradecanoylphorbol-13-acetate enhances tumor necrosis factor related apoptosis-inducing ligand induced apoptosis in prostate cancer cells. Clin Cancer Res. 2007 Dec 1;13(23):7181-90. [PubMed:18056199]
Wikipedia
Lexatumumab

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
2Not Yet RecruitingTreatmentLung Squamous Cell Carcinoma / Recurrent Lung Carcinoma / Stage IV Lung Cancer AJCC v8 / Stage IVA Lung Cancer AJCC v8 / Stage IVB Lung Cancer AJCC v81
2Not Yet RecruitingTreatmentMetastatic Lung Non-Small Cell Carcinoma / Recurrent Lung Non-Small Cell Carcinoma / Stage IV Lung Cancer AJCC v8 / Stage IVA Lung Cancer AJCC v8 / Stage IVB Lung Cancer AJCC v81
2RecruitingTreatmentCholangiocarcinomas / Liver and Intrahepatic Bile Duct Carcinoma / Stage III Gallbladder Cancer AJCC V7 / Stage III Intrahepatic Cholangiocarcinoma AJCC v7 / Stage IIIA Gallbladder Cancer AJCC v7 / Stage IIIB Gallbladder Cancer AJCC v7 / Stage IV Gallbladder Cancer AJCC v7 / Stage IVA Gallbladder Cancer AJCC v7 / Stage IVA Intrahepatic Cholangiocarcinoma AJCC v7 / Stage IVB Gallbladder Cancer AJCC v7 / Stage IVB Intrahepatic Cholangiocarcinoma AJCC v7 / Unresectable Gallbladder Carcinoma1
2RecruitingTreatmentLocally Advanced Thymic Carcinoma / Metastatic Thymic Carcinoma / Recurrent Thymic Carcinoma / Unresectable Thymic Carcinoma1
2RecruitingTreatmentMetastatic Lung Non-Squamous Non-Small Cell Carcinoma / Recurrent Lung Non-Squamous Non-Small Cell Carcinoma / Stage III Lung Cancer AJCC v8 / Stage IIIA Lung Cancer AJCC v8 / Stage IIIB Lung Cancer AJCC v8 / Stage IIIC Lung Cancer AJCC v8 / Stage IVA Lung Cancer AJCC v8 / Unresectable Lung Non-Squamous Non-Small Cell Carcinoma1
2RecruitingTreatmentMetastatic Non-Small Lung Cell Cancer / Recurrent Non-Small Lung Cell Cancer / Stage IV Lung Cancer AJCC v8 / Stage IVA Lung Cancer AJCC v8 / Stage IVB Lung Cancer AJCC v81
2RecruitingTreatmentMetastatic Small Intestinal Adenocarcinoma / Stage III Small Intestinal Adenocarcinoma AJCC v8 / Stage IIIA Small Intestinal Adenocarcinoma AJCC v8 / Stage IIIB Small Intestinal Adenocarcinoma AJCC v8 / Stage IV Small Intestinal Adenocarcinoma AJCC v81
2RecruitingTreatmentRecurrent Lung Non-Small Cell Carcinoma / Stage IV Lung Cancer AJCC v8 / Stage IVA Lung Cancer AJCC v8 / Stage IVB Lung Cancer AJCC v81
1TerminatedTreatmentEwing's Sarcoma (ES) / Neuroblastomas / Rhabdomyosarcomas / Sarcoma, Osteogenic1
1, 2RecruitingTreatmentMetastatic Esophageal Carcinoma / Metastatic Gastric carcinoma / Metastatic Gastroesophageal Junction Adenocarcinoma / Recurrent Esophageal Carcinoma / Recurrent Gastric Carcinoma / Recurrent Gastroesophageal Junction Adenocarcinoma / Stage III Esophageal Cancer AJCC v7 / Stage III Gastric Cancer AJCC v7 / Stage IIIA Esophageal Cancer AJCC v7 / Stage IIIA Gastric Cancer AJCC v7 / Stage IIIB Esophageal Cancer AJCC v7 / Stage IIIB Gastric Cancer AJCC v7 / Stage IIIC Esophageal Cancer AJCC v7 / Stage IIIC Gastric Cancer AJCC v7 / Stage IV Esophageal Cancer AJCC v7 / Stage IV Gastric Cancer AJCC v7 / Unresectable Esophageal Carcinoma / Unresectable Gastric Carcinoma / Unresectable Gastroesophageal Junction Adenocarcinoma1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage Forms
Not Available
Prices
Not Available
Patents
Not Available

Properties

State
Solid
Experimental Properties
Not Available

Targets

Kind
Protein
Organism
Humans
Pharmacological action
Unknown
General Function
Tumor necrosis factor-activated receptor activity
Specific Function
Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 pro...
Gene Name
TNFRSF10B
Uniprot ID
O14763
Uniprot Name
Tumor necrosis factor receptor superfamily member 10B
Molecular Weight
47877.885 Da
References
  1. Zhang X, Li W, Olumi AF: Low-dose 12-O-tetradecanoylphorbol-13-acetate enhances tumor necrosis factor related apoptosis-inducing ligand induced apoptosis in prostate cancer cells. Clin Cancer Res. 2007 Dec 1;13(23):7181-90. [PubMed:18056199]
  2. Maddipatla S, Hernandez-Ilizaliturri FJ, Knight J, Czuczman MS: Augmented antitumor activity against B-cell lymphoma by a combination of monoclonal antibodies targeting TRAIL-R1 and CD20. Clin Cancer Res. 2007 Aug 1;13(15 Pt 1):4556-64. [PubMed:17671142]

Drug created on March 19, 2008 10:39 / Updated on June 12, 2020 10:52

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Logo pink
Stay in the know!
As part of our commitment to providing the most up-to-date drug information, we will be releasing #DrugBankUpdates with our newly added curated drug pages.
#DrugBankUpdates