Lexatumumab

This drug entry is a stub and has not been fully annotated. It is scheduled to be annotated soon.

Identification

Generic Name
Lexatumumab
DrugBank Accession Number
DB06599
Background

Lexatumumab is a fully humanized, high-affinity immunoglobulin G(1 lambda) monoclonal antibody (mAb).

Type
Biotech
Groups
Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Protein Structure
Protein Chemical Formula
Not Available
Protein Average Weight
Not Available
Sequences
>8753_H|lexatumumab|Homo sapiens||H-GAMMA-1 (VH(1-121)+CH1(122-219)+HINGE-REGION(220-234)+CH2(235-344)+CH3(345-451))|||||||451||||MW 49117.4|MW 49117.4|
EVQLVQSGGGVERPGGSLRLSCAASGFTFDDYGMSWVRQAPGKGLEWVSGINWNGGSTGY
ADSVKGRVTISRDNAKNSLYLQMNSLRAEDTAVYYCAKILGAGRGWYFDLWGKGTTVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRE
EMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>8753_L|lexatumumab|Homo sapiens||L-LAMBDA (V-LAMBDA(1-108)+C-LAMBDA(109-214))|||||||214||||MW 22699.0|MW 22699.0|
SSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDR
FSGSSSGNTASLTITGAQAEDEADYYCNSRDSSGNHVVFGGGTKLTVLGQPKAAPSVTLF
PPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYL
SLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Download FASTA Format
Synonyms
  • Lexatumumab
External IDs
  • ETR2-ST01
  • HGS-1018
  • HGS-ETR2
  • HGS1018
  • TRAIL-R2

Pharmacology

Indication

Investigated for use/treatment in cancer/tumors (unspecified).

Reduce drug development failure rates
Build, train, & validate machine-learning models
with evidence-based and structured datasets.
See how
Build, train, & validate predictive machine-learning models with structured datasets.
See how
Contraindications & Blackbox Warnings
Prevent Adverse Drug Events Today
Tap into our Clinical API for life-saving information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.
Learn more
Avoid life-threatening adverse drug events with our Clinical API
Learn more
Pharmacodynamics

Not Available

Mechanism of action

Lexatumumab agonizes the tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) receptor 2 (TRAIL-R2), triggering the extrinsic apoptotic pathway.

TargetActionsOrganism
UTumor necrosis factor receptor superfamily member 10BNot AvailableHumans
Absorption

Not Available

Volume of distribution

Not Available

Protein binding

Not Available

Metabolism
Not Available
Route of elimination

Not Available

Half-life

Not Available

Clearance

Not Available

Adverse Effects
Improve decision support & research outcomes
With structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates. View sample adverse effects data in our new Data Library!
See the data
Improve decision support & research outcomes with our structured adverse effects data.
See a data sample
Toxicity

Not Available

Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Lexatumumab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Lexatumumab.
AducanumabThe risk or severity of adverse effects can be increased when Lexatumumab is combined with Aducanumab.
AlemtuzumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Lexatumumab.
AlirocumabThe risk or severity of adverse effects can be increased when Lexatumumab is combined with Alirocumab.
AmivantamabThe risk or severity of adverse effects can be increased when Lexatumumab is combined with Amivantamab.
AnifrolumabThe risk or severity of adverse effects can be increased when Lexatumumab is combined with Anifrolumab.
AnsuvimabThe risk or severity of adverse effects can be increased when Lexatumumab is combined with Ansuvimab.
Anthrax immune globulin humanThe risk or severity of adverse effects can be increased when Lexatumumab is combined with Anthrax immune globulin human.
Antilymphocyte immunoglobulin (horse)The risk or severity of adverse effects can be increased when Lexatumumab is combined with Antilymphocyte immunoglobulin (horse).
Identify potential medication risks
Easily compare up to 40 drugs with our drug interaction checker.
Get severity rating, description, and management advice.
Learn more
Food Interactions
Not Available

Categories

Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available
Affected organisms
Not Available

Chemical Identifiers

UNII
967Q0SJD77
CAS number
845816-02-6

References

General References
  1. Maddipatla S, Hernandez-Ilizaliturri FJ, Knight J, Czuczman MS: Augmented antitumor activity against B-cell lymphoma by a combination of monoclonal antibodies targeting TRAIL-R1 and CD20. Clin Cancer Res. 2007 Aug 1;13(15 Pt 1):4556-64. [Article]
  2. Zhang X, Li W, Olumi AF: Low-dose 12-O-tetradecanoylphorbol-13-acetate enhances tumor necrosis factor related apoptosis-inducing ligand induced apoptosis in prostate cancer cells. Clin Cancer Res. 2007 Dec 1;13(23):7181-90. [Article]
Wikipedia
Lexatumumab

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
2Active Not RecruitingTreatmentLocally Advanced Thymic Carcinoma / Metastatic Thymic Carcinoma / Recurrent Thymic Carcinoma / Unresectable Thymic Carcinoma1
2Active Not RecruitingTreatmentMetastatic Non-Small Cell Lung Cancer / Recurrent Non-Small Cell Lung Carcinoma / Stage IV Lung Cancer AJCC v8 / Stage IVA Lung Cancer AJCC v8 / Stage IVB Lung Cancer AJCC v81
2Active Not RecruitingTreatmentMetastatic Non-squamous Non-small-cell Lung Cancer (NSQ NSCLC) / Recurrent Non-Squamous Non-Small Cell Lung Carcinoma / Stage IV Lung Cancer AJCC v81
2Active Not RecruitingTreatmentRecurrent Non-Small Cell Lung Carcinoma / Stage IV Lung Cancer AJCC v8 / Stage IVA Lung Cancer AJCC v8 / Stage IVB Lung Cancer AJCC v81
2CompletedTreatmentCholangiocarcinoma / Liver and Intrahepatic Bile Duct Carcinoma / Stage III Gallbladder Cancer AJCC V7 / Stage III Intrahepatic Cholangiocarcinoma AJCC v7 / Stage IIIA Gallbladder Cancer AJCC v7 / Stage IIIB Gallbladder Cancer AJCC v7 / Stage IV Gallbladder Cancer AJCC v7 / Stage IVA Gallbladder Cancer AJCC v7 / Stage IVA Intrahepatic Cholangiocarcinoma AJCC v7 / Stage IVB Gallbladder Cancer AJCC v7 / Stage IVB Intrahepatic Cholangiocarcinoma AJCC v7 / Unresectable Gallbladder Carcinoma1
2Not Yet RecruitingTreatmentRecurrent Non-Small Cell Lung Carcinoma / Stage IV Lung Cancer AJCC v81
2RecruitingTreatmentClinical Stage III Gastric Cancer AJCC v8 / Clinical Stage III Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IV Gastric Cancer AJCC v8 / Clinical Stage IV Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IVA Gastric Cancer AJCC v8 / Clinical Stage IVA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IVB Gastric Cancer AJCC v8 / Clinical Stage IVB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Locally Advanced Unresectable Gastric Adenocarcinoma / Metastatic Gastric Adenocarcinoma / Metastatic Gastroesophageal Junction Adenocarcinoma / Pathologic Stage III Gastric Cancer AJCC v8 / Pathologic Stage III Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIIA Gastric Cancer AJCC v8 / Pathologic Stage IIIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIIB Gastric Cancer AJCC v8 / Pathologic Stage IIIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIIC Gastric Cancer AJCC v8 / Pathologic Stage IV Gastric Cancer AJCC v8 / Pathologic Stage IV Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IVA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IVB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Postneoadjuvant Therapy Stage III Gastric Cancer AJCC v8 / Postneoadjuvant Therapy Stage III Gastroesophageal Junction Adenocarcinoma AJCC v8 / Postneoadjuvant Therapy Stage IIIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Postneoadjuvant Therapy Stage IIIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Postneoadjuvant Therapy Stage IV Gastric Cancer AJCC v8 / Postneoadjuvant Therapy Stage IV Gastroesophageal Junction Adenocarcinoma AJCC v8 / Postneoadjuvant Therapy Stage IVA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Postneoadjuvant Therapy Stage IVB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Unresectable, locally advanced Adenocarcinomas of the Gastroesophageal Junction1
2RecruitingTreatmentMetastatic Non-Small Cell Lung Cancer / Recurrent Non-small Cell Lung Cancer / Stage IV Lung Cancer AJCC v8 / Stage IVA Lung Cancer AJCC v8 / Stage IVB Lung Cancer AJCC v81
2RecruitingTreatmentMetastatic Small Intestinal Adenocarcinoma / Stage III Small Intestinal Adenocarcinoma AJCC v8 / Stage IIIA Small Intestinal Adenocarcinoma AJCC v8 / Stage IIIB Small Intestinal Adenocarcinoma AJCC v8 / Stage IV Small Intestinal Adenocarcinoma AJCC v81
2RecruitingTreatmentRecurrent Non-Small Cell Lung Carcinoma / Stage IV Lung Cancer AJCC v81

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage Forms
Not Available
Prices
Not Available
Patents
Not Available

Properties

State
Solid
Experimental Properties
Not Available

Targets

Build, predict & validate machine-learning models
Use our structured and evidence-based datasets to unlock new
insights and accelerate drug research.
Learn more
Use our structured and evidence-based datasets to unlock new insights and accelerate drug research.
Learn more
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
General Function
Tumor necrosis factor-activated receptor activity
Specific Function
Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 pro...
Gene Name
TNFRSF10B
Uniprot ID
O14763
Uniprot Name
Tumor necrosis factor receptor superfamily member 10B
Molecular Weight
47877.885 Da
References
  1. Zhang X, Li W, Olumi AF: Low-dose 12-O-tetradecanoylphorbol-13-acetate enhances tumor necrosis factor related apoptosis-inducing ligand induced apoptosis in prostate cancer cells. Clin Cancer Res. 2007 Dec 1;13(23):7181-90. [Article]
  2. Maddipatla S, Hernandez-Ilizaliturri FJ, Knight J, Czuczman MS: Augmented antitumor activity against B-cell lymphoma by a combination of monoclonal antibodies targeting TRAIL-R1 and CD20. Clin Cancer Res. 2007 Aug 1;13(15 Pt 1):4556-64. [Article]

Drug created at March 19, 2008 16:39 / Updated at February 21, 2021 18:52