Ixekizumab

Identification

Summary

Ixekizumab is a monoclonal antibody used to treat moderate to severe plaque psoriasis.

Brand Names

Taltz

Generic Name

Ixekizumab

DrugBank Accession Number

DB11569

Background

Ixekizumab is a humanized immunoglobulin G subclass 4 (IgG4) monoclonal antibody (mAb) against interleukin-17A (IL-17A) and prevents it from interacting with the IL-17A receptor. As IL-17A is a pro-inflammatory cytokine involved in inflammation and immune responses, blocking its effect is beneficial for use in inflammatory conditions. In particular, IL-17A has been found to be implicated in a variety of autoimmune diseases including Rheumatoid Arthritis and plaque psoriasis.

Ixekizumab is produced by recombinant DNA technology in a recombinant mammalian cell line and purified using standard technology for bioprocessing. Ixekizumab is comprised of two identical light chain polypeptides of 219 amino acids each and two identical heavy chain polypeptides of 445 amino acids each, and has a molecular weight of 146,158 Daltons for the protein backbone of the molecule. It is indicated for the treatment of adults with moderate-to-severe plaque psoriasis who are candidates for systemic therapy or phototherapy.

Type

Biotech

Groups

Approved, Investigational

Biologic Classification

Protein Based Therapies
Monoclonal antibody (mAb)

Protein Chemical Formula

C₆₄₉₂H₁₀₀₁₂N₁₇₂₈O₂₀₂₈S₄₆

Protein Average Weight

146158.0 Da

Sequences

>Heavy Chain Sequence
QVQLVQSGAEVKKPGSSVKVSCKASGYSFTDYHIHWVRQAPGQGLEWMGVINPMYGTTDY
NQRFKGRVTITADESTSTAYMELSSLRSEDTAVYYCARYDYFTGTGVYWGQGTLVTVSSA
STKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVF
LFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYR
VVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN
QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGN
VFSCSVMHEALHNHYTQKSLSLSLG

>Light Chain Sequence
DIVMTQTPLSLSVTPGQPASISCRSSRSLVHSRGNTYLHWYLQKPGQSPQLLIYKVSNRF
IGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQSTHLPFTFGQGTKLEIKRTVAAPSV
FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL
SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Download FASTA Format

Synonyms

Ixekizumab

External IDs

LY 2439821
LY-2439821
LY2439821

Pharmacology

Indication

Ixekizumab is indicated for the treatment of patients aged six years or older with moderate-to-severe plaque psoriasis who are candidates for systemic therapy or phototherapy. It is also indicated in adult patients with active psoriatic arthritis, ankylosing spondylitis, or non-radiographic axial spondyloarthritis with objective signs of inflammation.⁴

Reduce drug development failure rates

Build, train, & validate machine-learning models
with evidence-based and structured datasets.

See how

Build, train, & validate predictive machine-learning models with structured datasets.

See how

Associated Conditions

Contraindications & Blackbox Warnings

Prevent Adverse Drug Events Today

Tap into our Clinical API for life-saving information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.

Learn more

Avoid life-threatening adverse drug events with our Clinical API

Learn more

Pharmacodynamics

Not Available

Mechanism of action

Target	Actions	Organism
AInterleukin-17A	antibody	Humans

Absorption

Following a single subcutaneous dose of 160 mg in subjects with plaque psoriasis, ixekizumab reached peak mean (±SD) serum concentrations (Cmax) of 16.2 ±6.6 mcg/mL by approximately 4 days post dose.

Volume of distribution

The mean (geometric CV%) volume of distribution at steady-state was 7.11 L (29%) in subjects with plaque psoriasis.

Protein binding

Not Available

Metabolism

The metabolic pathway of ixekizumab has not been characterized. As a humanized IgG4 monoclonal antibody ixekizumab is expected to be degraded into small peptides and amino acids via catabolic pathways in the same manner as endogenous IgG.

Route of elimination

Not Available

Half-life

13 days

Clearance

0.39 L/day

Adverse Effects

Improve decision support & research outcomes

With structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates. View sample adverse effects data in our new Data Library!

See the data

Improve decision support & research outcomes with our structured adverse effects data.

See a data sample

Toxicity

The most common adverse reactions associated with Ixekizumab treatment are injection site reactions, upper respiratory tract infections, nausea, and tinea infections.

Pathways

Not Available

Pharmacogenomic Effects/ADRs

Not Available

Interactions

Drug Interactions

This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.

Drug	Interaction
Integrate drug-drug interactions in your software
Abatacept	The risk or severity of adverse effects can be increased when Abatacept is combined with Ixekizumab.
Abciximab	The risk or severity of adverse effects can be increased when Abciximab is combined with Ixekizumab.
Adalimumab	The risk or severity of adverse effects can be increased when Adalimumab is combined with Ixekizumab.
Adenovirus type 7 vaccine live	The risk or severity of infection can be increased when Adenovirus type 7 vaccine live is combined with Ixekizumab.
Aducanumab	The risk or severity of adverse effects can be increased when Ixekizumab is combined with Aducanumab.
Aldesleukin	The risk or severity of adverse effects can be increased when Aldesleukin is combined with Ixekizumab.
Alefacept	The risk or severity of adverse effects can be increased when Alefacept is combined with Ixekizumab.
Alemtuzumab	The risk or severity of adverse effects can be increased when Alemtuzumab is combined with Ixekizumab.
Alirocumab	The risk or severity of adverse effects can be increased when Alirocumab is combined with Ixekizumab.
Allogeneic processed thymus tissue	The therapeutic efficacy of Allogeneic processed thymus tissue can be decreased when used in combination with Ixekizumab.

Identify potential medication risks

Easily compare up to 40 drugs with our drug interaction checker.

Get severity rating, description, and management advice.

Learn more

Food Interactions

No interactions found.

Products

Drug product information from 10+ global regions

Our datasets provide approved product information including:
dosage, form, labeller, route of administration, and marketing period.

Access now

Access drug product information from over 10 global regions.

Access now

Brand Name Prescription Products

Name	Dosage	Strength	Route	Labeller	Marketing Start	Marketing End
Taltz	Solution	80 mg / mL	Subcutaneous	Eli Lilly & Co. Ltd.	2016-08-11	Not applicable
Taltz	Injection, solution	80 mg	Subcutaneous	Eli Lilly And Company (Ireland) Limited	2016-09-08	Not applicable
Taltz	Injection, solution	80 mg/1mL	Subcutaneous	Eli Lilly and Company	2016-03-22	Not applicable
Taltz	Injection, solution	80 mg	Subcutaneous	Eli Lilly And Company (Ireland) Limited	2016-09-08	Not applicable
Taltz	Solution	80 mg / mL	Subcutaneous	Eli Lilly & Co. Ltd.	2016-08-11	Not applicable
Taltz	Injection, solution	80 mg	Subcutaneous	Eli Lilly And Company (Ireland) Limited	2016-09-08	Not applicable
Taltz	Injection, solution	80 mg	Subcutaneous	Eli Lilly And Company (Ireland) Limited	2016-09-08	Not applicable
Taltz	Injection, solution	80 mg/1mL	Subcutaneous	Eli Lilly and Company	2016-03-22	Not applicable
Taltz	Injection, solution	80 mg	Subcutaneous	Eli Lilly And Company (Ireland) Limited	2016-09-08	Not applicable
Taltz	Injection, solution	80 mg	Subcutaneous	Eli Lilly And Company (Ireland) Limited	2016-09-08	Not applicable

Chemical Identifiers

UNII: BTY153760O
CAS number: 1143503-69-8

References

General References

Dyring-Andersen B, Skov L, Zachariae C: Ixekizumab for treatment of psoriasis. Expert Rev Clin Immunol. 2015 Apr;11(4):435-42. doi: 10.1586/1744666X.2015.1023295. Epub 2015 Mar 8. [Article]
Genovese MC, Van den Bosch F, Roberson SA, Bojin S, Biagini IM, Ryan P, Sloan-Lancaster J: LY2439821, a humanized anti-interleukin-17 monoclonal antibody, in the treatment of patients with rheumatoid arthritis: A phase I randomized, double-blind, placebo-controlled, proof-of-concept study. Arthritis Rheum. 2010 Apr;62(4):929-39. doi: 10.1002/art.27334. [Article]
Bush KA, Farmer KM, Walker JS, Kirkham BW: Reduction of joint inflammation and bone erosion in rat adjuvant arthritis by treatment with interleukin-17 receptor IgG1 Fc fusion protein. Arthritis Rheum. 2002 Mar;46(3):802-5. [Article]
FDA Approved Drug Products: TALTZ (ixekizumab) injection [Link]

External Links

KEGG Drug: D10071
PubChem Substance: 347911203
RxNav: 1745099
ChEMBL: CHEMBL1743034
RxList: RxList Drug Page
Drugs.com: Drugs.com Drug Page
Wikipedia: Ixekizumab

FDA label

Download (6.58 MB)

Clinical Trials

Clinical Trials

Phase	Status	Purpose	Conditions	Count
4	Completed	Treatment	Erythrodermic psoriasis / Generalized Pustular Psoriasis (GPP)	1
4	Completed	Treatment	Psoriasis Vulgaris (Plaque Psoriasis)	1
4	Completed	Treatment	Psoriatic Arthritis	1
4	Recruiting	Other	Psoriasis Vulgaris (Plaque Psoriasis)	1
4	Recruiting	Prevention	Coronavirus Disease 2019 (COVID‑19) / Psoriatic Arthritis / Rheumatoid Arthritis / Spondylarthritis	1
4	Recruiting	Treatment	Anterior Uveitis (AU) / Panuveitis / Posterior Uveitis / Uveitis, Intermediate	1
4	Recruiting	Treatment	Psoriasis Vulgaris (Plaque Psoriasis) / Psoriatic Arthritis	1
4	Recruiting	Treatment	Psoriasis / Psoriasis Vulgaris (Plaque Psoriasis)	1
3	Completed	Treatment	Axial Spondyloarthritis (AxSpA)	2
3	Completed	Treatment	Coronavirus Disease 2019 (COVID‑19)	1

Pharmacoeconomics

Manufacturers

Not Available

Packagers

Not Available

Dosage Forms

Form	Route	Strength
Injection, solution
Injection, solution		80 mg/1ml
Injection, solution	Parenteral; Subcutaneous	80 MG
Injection, solution	Subcutaneous	80 mg
Injection, solution	Subcutaneous	80 mg/1mL
Solution	Subcutaneous	80 mg / mL
Solution	Subcutaneous	80 mg
Solution	Subcutaneous	80.000 mg
Injection, solution	Subcutaneous
Injection, solution	Subcutaneous	80 mg/ml
Injection, solution		80 mg/ml

Prices

Not Available

Patents

Not Available

Properties

State: Solid
Experimental Properties: Not Available

Targets

Build, predict & validate machine-learning models

Use our structured and evidence-based datasets to unlock new
insights and accelerate drug research.

Learn more

Use our structured and evidence-based datasets to unlock new insights and accelerate drug research.

Learn more

Details1. Interleukin-17A

Kind: Protein
Organism: Humans
Pharmacological action: Yes
Actions: Antibody

General Function: Cytokine receptor binding
Specific Function: Induces stromal cells to produce proinflammatory and hematopoietic cytokines. Enhances the surface expression of ICAM1/intracellular adhesion molecule 1 in fibroblasts.
Gene Name: IL17A
Uniprot ID: Q16552
Uniprot Name: Interleukin-17A
Molecular Weight: 17503.92 Da

Drug created at April 06, 2016 15:41 / Updated at June 03, 2022 07:24

Ixekizumab

Identification

Pharmacology

Interactions

Products

Categories

Chemical Identifiers

References

Clinical Trials

Pharmacoeconomics

Properties

Targets