Sulfotransferase family cytosolic 1B member 1

Details

Name
Sulfotransferase family cytosolic 1B member 1
Synonyms
  • 2.8.2.-
  • ST1B1
  • ST1B2
  • Sulfotransferase 1B2
  • SULT1B2
  • Thyroid hormone sulfotransferase
Gene Name
SULT1B1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0011826|Sulfotransferase family cytosolic 1B member 1
MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDM
ILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFW
ENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNW
WKKKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVN
YTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI
Number of residues
296
Molecular Weight
34898.955
Theoretical pI
7.07
GO Classification
Functions
aryl sulfotransferase activity / sulfotransferase activity
Processes
3'-phosphoadenosine 5'-phosphosulfate metabolic process / cellular biogenic amine metabolic process / epithelial cell differentiation / flavonoid metabolic process / phenol-containing compound metabolic process / small molecule metabolic process / steroid metabolic process / sulfation / thyroid hormone metabolic process / xenobiotic metabolic process
Components
cytosol
General Function
Sulfotransferase activity
Specific Function
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates dopamine, small phenols such as 1-naphthol and p-nitrophenol and thyroid hormones, including 3,3'-diiodothyronine, triidothyronine, reverse triiodothyronine and thyroxine.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0011827|Sulfotransferase family cytosolic 1B member 1 (SULT1B1)
ATGCTTTCCCCAAAAGATATTCTGCGAAAAGATCTGAAGTTGGTCCATGGTTATCCCATG
ACCTGTGCTTTTGCAAGCAACTGGGAAAAAATTGAACAGTTCCATAGCAGACCAGATGAC
ATTGTGATAGCCACTTATCCTAAATCAGGTACTACTTGGGTTAGTGAAATTATAGACATG
ATTCTAAATGATGGAGATATTGAAAAATGTAAGCGAGGTTTTATTACTGAAAAAGTTCCA
ATGTTGGAAATGACTCTCCCTGGATTAAGAACATCAGGTATAGAACAATTGGAGAAGAAT
CCATCACCCCGGATTGTGAAAACACATCTACCGACTGATCTTCTTCCTAAATCTTTCTGG
GAAAACAATTGCAAGATGATTTATCTGGCTCGTAATGCCAAGGATGTTTCAGTCTCATAT
TACCATTTTGACTTAATGAATAATTTACAGCCTTTTCCTGGTACCTGGGAAGAATATCTG
GAGAAATTCTTAACTGGAAAAGTGGCCTATGGTTCCTGGTTTACTCATGTTAAAAACTGG
TGGAAGAAAAAGGAAGAACACCCAATACTTTTTTTGTACTATGAAGATATGAAAGAGAAT
CCAAAGGAGGAAATCAAGAAGATCATTAGATTTCTAGAGAAGAACCTGAATGATGAGATC
TTGGATAGGATCATCCATCACACCTCATTTGAAGTGATGAAGGACAATCCTTTGGTAAAT
TATACACATCTACCAACTACAGTGATGGATCATAGCAAATCCCCTTTTATGCGTAAAGGG
ACGGCTGGTGACTGGAAGAATTACTTCACCGTGGCCCAAAATGAGAAATTTGATGCTATT
TATGAGACAGAAATGTCCAAAACTGCACTTCAATTCCGCACAGAGATTTAA
Chromosome Location
4
Locus
4q13.3
External Identifiers
ResourceLink
UniProtKB IDO43704
UniProtKB Entry NameST1B1_HUMAN
GenBank Gene IDD89479
GenAtlas IDSULT1B1
HGNC IDHGNC:17845
General References
  1. Fujita K, Nagata K, Ozawa S, Sasano H, Yamazoe Y: Molecular cloning and characterization of rat ST1B1 and human ST1B2 cDNAs, encoding thyroid hormone sulfotransferases. J Biochem. 1997 Nov;122(5):1052-61. [Article]
  2. Wang J, Falany JL, Falany CN: Expression and characterization of a novel thyroid hormone-sulfating form of cytosolic sulfotransferase from human liver. Mol Pharmacol. 1998 Feb;53(2):274-82. [Article]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  4. Dombrovski L, Dong A, Bochkarev A, Plotnikov AN: Crystal structures of human sulfotransferases SULT1B1 and SULT1C1 complexed with the cofactor product adenosine-3'- 5'-diphosphate (PAP). Proteins. 2006 Sep 1;64(4):1091-4. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01812Adenosine 3',5'-diphosphateexperimentalunknownDetails
DB14635Curcumin sulfateexperimentalunknownsubstrateDetails
DB09100Thyroid, porcineapprovedunknownsubstrateDetails
DB00714Apomorphineapproved, investigationalunknownsubstrateDetails
DB00871TerbutalineapprovedunknownsubstrateDetails
DB00960Pindololapproved, investigationalunknownsubstrateDetails
DB00968MethyldopaapprovednosubstrateDetails
DB12471Ibrexafungerpapproved, investigationalunknownsubstrateDetails