Basiliximab

Identification

Name
Basiliximab
Accession Number
DB00074
Description

A recombinant chimeric (murine/human) monoclonal antibody (IgG1k) that functions as an immunosuppressive agent, specifically binding to and blocking the interleukin-2 receptor a-chain (IL-2R alpha, also known as CD25 antigen) on the surface of activated T-lymphocytes. It is a 144 kDa glycoprotein obtained from fermentation of an established mouse myeloma cell line genetically engineered to express plasmids containing the human heavy and light chain constant region genes and mouse heavy and light chain variable region genes encoding the RFT5 antibody that binds selectively to the IL-2R alpha.

Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Protein Structure
Db00074
Protein Chemical Formula
C6378H9844N1698O1997S48
Protein Average Weight
143801.3 Da
Sequences
>Basiliximab heavy chain
QLQQSGTVLARPGASVKMSCKASGYSFTRYWMHWIKQRPGQGLEWIGAIYPGNSDTSYNQ
KFEGKAKLTAVTSASTAYMELSSLTHEDSAVYYCSRDYGYYFDFWGQGTTLTVSSASTKG
PSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL
SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPPKSCDKTHTCPPCPAPELLGGPSVF
LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR
VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKN
QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN
VFSCSVMHEALHNHYTQKSLSLSPGK
>Basiliximab light chain
QIVSTQSPAIMSASPGEKVTMTCSASSSRSYMQWYQQKPGTSPKRWIYDTSKLASGVPAR
FSGSGSGTSYSLTISSMEAEDAATYYCHQRSSYTFGGGTKLEIKRTVAAPSVFIFPPSDE
QLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSK
ADYEKHKVYACEVTHQGLSSPVTKSFNRGE
Download FASTA Format
Synonyms
  • Basiliximab
External IDs
  • CHI-621
  • SDZ-CHI-621

Pharmacology

Indication

For prophylactic treatment of kidney transplant rejection

Associated Conditions
Contraindications & Blackbox Warnings
Learn about our commercial Contraindications & Blackbox Warnings data.
Learn More
Pharmacodynamics

Basiliximab functions as an IL-2 receptor antagonist. Specifically it inhibits IL-2-mediated activation of lymphocytes, a critical pathway in the cellular immune response involved in allograft rejection.

Mechanism of action

Basiliximab binds with high-affinity to the alpha-subunit (CD25) of the high-affinity IL-2 receptor. This inhibits IL-2 binding, which inhibits T-cell activation and prevents the body from mounting an immune response against the foreign kidney.

TargetActionsOrganism
AInterleukin-2 receptor subunit alpha
antibody
Humans
UInterleukin-2 receptor subunit beta
antibody
Humans
Absorption
Not Available
Volume of distribution
  • 7.8 ± 5.1 L [Pediatric]
  • 4.8 ± 2.1 L [Adult]
Protein binding
Not Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system when bound to lymphocytes, or by human antimurine antibody production

Route of elimination
Not Available
Half-life

7.2 +/- 3.2 days (adults)

Clearance
  • 41 +/- 19 mL/h [Adult patients undergoing first kidney transplantation]
  • 17 +/- 6 mL/h [pediatric patients undergoing renal transplantation]
  • 31 +/- 19 mL/h [adolescent patients undergoing renal transplantation]
Adverse Effects
Learn about our commercial Adverse Effects data.
Learn More
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
AbataceptThe risk or severity of adverse effects can be increased when Basiliximab is combined with Abatacept.
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Basiliximab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Basiliximab.
Adenovirus type 7 vaccine liveThe risk or severity of infection can be increased when Adenovirus type 7 vaccine live is combined with Basiliximab.
AldesleukinThe risk or severity of adverse effects can be increased when Aldesleukin is combined with Basiliximab.
AlefaceptThe risk or severity of adverse effects can be increased when Basiliximab is combined with Alefacept.
AlemtuzumabThe risk or severity of adverse effects can be increased when Basiliximab is combined with Alemtuzumab.
AlirocumabThe risk or severity of adverse effects can be increased when Basiliximab is combined with Alirocumab.
AltretamineThe risk or severity of adverse effects can be increased when Basiliximab is combined with Altretamine.
AmsacrineThe risk or severity of adverse effects can be increased when Basiliximab is combined with Amsacrine.
Additional Data Available
  • Extended Description
    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
Not Available

Products

Brand Name Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing EndRegionImage
SimulectInjection, powder, for solution20 mgIntravenousNovartis Europharm Limited1998-10-09Not applicableEU flag
SimulectPowder, for solutionIntravenousNovartis2000-10-23Not applicableCanada flag
SimulectInjection, powder, for solution10 mg/2.5mLIntravenousNovartis Pharmaceuticals Corporation1998-05-12Not applicableUS flag
SimulectInjection, powder, for solution10 mgIntravenousNovartis Europharm Limited1998-10-09Not applicableEU flag
SimulectInjection, powder, for solution20 mg/5mLIntravenousNovartis Pharmaceuticals Corporation1998-05-12Not applicableUS flag
Additional Data Available
  • Application Number
    Application Number

    A unique ID assigned by the FDA when a product is submitted for approval by the labeller.

    Learn more
  • Product Code
    Product Code

    A governmentally-recognized ID which uniquely identifies the product within its regulatory market.

    Learn more

Categories

ATC Codes
L04AC02 — Basiliximab
Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Chemical Identifiers

UNII
9927MT646M
CAS number
179045-86-4

References

General References
Not Available
UniProt
P01857
Genbank
J00228
PubChem Substance
46505169
RxNav
196102
ChEMBL
CHEMBL1201439
Therapeutic Targets Database
DAP000388
PharmGKB
PA164747126
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Basiliximab
AHFS Codes
  • 92:44.00 — Immunosuppressive Agents
FDA label
Download (506 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
4Active Not RecruitingTreatmentGlomerulonephritis / IgAN1
4Active Not RecruitingTreatmentKidney Transplant Patients1
4CompletedPreventionAdverse Effects / Transplantation, Kidney1
4CompletedPreventionDisorder Related to Renal Transplantation1
4CompletedPreventionTransplantation, Kidney2
4CompletedPreventionTransplantation, Liver1
4CompletedPreventionTransplantation, Renal1
4CompletedTreatmentChronic Kidney Disease (CKD) / End Stage Renal Disease (ESRD) / Hemodialysis Treatment / Renal Replacement Therapies / Transplantation, Renal1
4CompletedTreatmentChronic Renal Diseases1
4CompletedTreatmentChronic Renal Failure (CRF)1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
  • Novartis AG
Dosage Forms
FormRouteStrength
Injection, powder, for solution
Injection, powder, for solution10 mg
Injection, powder, for solution20 mg
Injection, powder, for solutionIntravenous10 mg
Injection, powder, for solutionIntravenous10 mg/2.5mL
Injection, powder, for solutionIntravenous20 mg
Injection, powder, for solutionIntravenous20 mg/5mL
Injection, powder, for solutionIntravenous; Intravenous bolus20 MG
Powder, for solutionIntravenous
InjectionIntravenous20 mg
Injection
Prices
Unit descriptionCostUnit
Simulect 20 mg vial2471.6USD vial
Simulect 10 mg vial1883.11USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)Region
CA2038279No1999-03-092011-03-11Canada flag
Additional Data Available
  • Filed On
    Filed On

    The date on which a patent was filed with the relevant government.

    Learn more

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.473Not Available
isoelectric point8.68Not Available

Targets

Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Antibody
General Function
Interleukin-2 receptor activity
Specific Function
Receptor for interleukin-2. The receptor is involved in the regulation of immune tolerance by controlling regulatory T cells (TREGs) activity. TREGs suppress the activation and expansion of autorea...
Gene Name
IL2RA
Uniprot ID
P01589
Uniprot Name
Interleukin-2 receptor subunit alpha
Molecular Weight
30818.915 Da
References
  1. Choy BY, Chan TM, Li FK, Lui SL, Lo WK, Yip T, Tse KC, Lai KN: IL2-receptor antagonist (basiliximab) induction therapy is associated with lower morbidity and mortality in renal transplant recipients. Transplant Proc. 2003 Feb;35(1):195. [PubMed:12591363]
  2. Kovarik J, Breidenbach T, Gerbeau C, Korn A, Schmidt AG, Nashan B: Disposition and immunodynamics of basiliximab in liver allograft recipients. Clin Pharmacol Ther. 1998 Jul;64(1):66-72. [PubMed:9695721]
  3. Garcia CD, Bittencourt VB, Tumelero A, Antonello JS, Malheiros D, Garcia VD: Plasmapheresis for recurrent posttransplant focal segmental glomerulosclerosis. Transplant Proc. 2006 Jul-Aug;38(6):1904-5. [PubMed:16908318]
  4. Berard JL, Velez RL, Freeman RB, Tsunoda SM: A review of interleukin-2 receptor antagonists in solid organ transplantation. Pharmacotherapy. 1999 Oct;19(10):1127-37. [PubMed:10512062]
  5. Mentre F, Kovarik J, Gerbeau C: Constructing a prediction interval for time to reach a threshold concentration based on a population pharmacokinetic analysis: an application to basiliximab in renal transplantation. J Pharmacokinet Biopharm. 1999 Apr;27(2):213-30. [PubMed:10567956]
  6. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
Actions
Antibody
General Function
Interleukin-2 receptor activity
Specific Function
Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2.
Gene Name
IL2RB
Uniprot ID
P14784
Uniprot Name
Interleukin-2 receptor subunit beta
Molecular Weight
61116.59 Da
References
  1. Onrust SV, Wiseman LR: Basiliximab. Drugs. 1999 Feb;57(2):207-13; discussion 214. [PubMed:10188761]
  2. Hausen B, Gummert J, Berry GJ, Christians U, Serkova N, Ikonen T, Hook L, Legay F, Schuler W, Schreier MH, Morris RE: Prevention of acute allograft rejection in nonhuman primate lung transplant recipients: induction with chimeric anti-interleukin-2 receptor monoclonal antibody improves the tolerability and potentiates the immunosuppressive activity of a regimen using low doses of both microemulsion cyclosporine and 40-O-(2-hydroxyethyl)-rapamycin. Transplantation. 2000 Feb 27;69(4):488-96. [PubMed:10708100]
  3. Schmitz K, Hitzer S, Behrens-Baumann W: [Immune suppression by combination therapy with basiliximab and cyclosporin in high risk keratoplasty. A pilot study]. Ophthalmologe. 2002 Jan;99(1):38-45. [PubMed:11840795]
  4. Warle MC, Kwekkeboom J, Tilanus HW, Metselaar HJ: Basiliximab interferes with the detection of soluble IL-2 receptor by the Immulite Immunoassay system. J Immunol Methods. 2003 Apr 1;275(1-2):133-6. [PubMed:12667677]
  5. Emparan C, Laukotter M, Wolters H, Dame C, Heidenreich S, Senninger N: Calcineurin-free protocols with basiliximab induction allow patients included in "old to old" programs achieve standard kidney transplant function. Transplant Proc. 2003 Jun;35(4):1326-7. [PubMed:12826150]
  6. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]

Drug created on June 13, 2005 07:24 / Updated on October 29, 2020 19:26

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Logo pink
Stay in the know!
As part of our commitment to providing the most up-to-date drug information, we will be releasing #DrugBankUpdates with our newly added curated drug pages.
#DrugBankUpdates