Muromonab

Identification

Name
Muromonab
Accession Number
DB00075
Description

Murine monoclonal antibody specific to CD3 T-cell lymphocyte antigens. More specifically it is a purified murine (mouse) monoclonal antibody, directed against the CD3 (T3) receptor on the surface of human T-cells (T-lymphocytes) cultured using the murine ascites method. Muromonab is 93% monomeric immune globulin G type 2a (IgG2a).

Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Protein Structure
Db00075
Protein Chemical Formula
C6460H9946N1720O2043S56
Protein Average Weight
146189.7 Da
Sequences
>Muromonab-CD3 light chain
QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMNWYQQKSGTSPKRWIYDTSKLASGVPAH
FRGSGSGTSYSLTISGMEAEDAATYYCQQWSSNPFTFGSGTKLEINRADTAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>Muromonab-CD3 heavy chain
QVQLQQSGAELARPGASVKMSCKASGYTFTRYTMHWVKQRPGQGLEWIGYINPSRGYTNY
NQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSSA
KTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL
YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE
LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Download FASTA Format
Synonyms
  • Anti-CD3
  • Muromonab-CD3

Pharmacology

Indication

For treatment of organ transplant recipients, prevention of organ rejection

Associated Conditions
Contraindications & Blackbox Warnings
Learn about our commercial Contraindications & Blackbox Warnings data.
Learn More
Pharmacodynamics

Used in organ transplant prophylaxis, Muromonab or OKT-3 binds specifically to the CD-3 complex, which is involved in antigen recognition and cell stimulation, on the surface of T lymphocytes. Immediately after administration CD-3-positive T lymphocytes are abruptly removed from circulation. It has been effective in reversing corticosteroid-resistant acute rejection in renal, liver, and cardiac transplant recipients.

Mechanism of action

Muromonab binds to the T-cell surface glycoprotein CD3 epsilon chain. It appears to kill CD-3 positive cells by inducing Fc mediated apoptosis, antibody mediated cytotoxicity and complement-dependent cytotoxicity.

TargetActionsOrganism
AT-cell surface glycoprotein CD3 delta chainNot AvailableHumans
AT-cell surface glycoprotein CD3 epsilon chain
binder
Humans
AT-cell surface glycoprotein CD3 gamma chainNot AvailableHumans
AT-cell surface glycoprotein CD3 zeta chainNot AvailableHumans
ULow affinity immunoglobulin gamma Fc region receptor III-BNot AvailableHumans
Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system when bound to T lymphocytes, or by human antimurine antibody production

Route of elimination
Not Available
Half-life

0.8 hours (mammalian reticulocytes, in vitro)

Clearance
Not Available
Adverse Effects
Learn about our commercial Adverse Effects data.
Learn More
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
AbataceptThe risk or severity of adverse effects can be increased when Muromonab is combined with Abatacept.
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Muromonab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Muromonab.
Adenovirus type 7 vaccine liveThe risk or severity of infection can be increased when Adenovirus type 7 vaccine live is combined with Muromonab.
AldesleukinThe risk or severity of adverse effects can be increased when Aldesleukin is combined with Muromonab.
AlefaceptThe risk or severity of adverse effects can be increased when Muromonab is combined with Alefacept.
AlemtuzumabThe risk or severity of adverse effects can be increased when Muromonab is combined with Alemtuzumab.
AlirocumabThe risk or severity of adverse effects can be increased when Muromonab is combined with Alirocumab.
AltretamineThe risk or severity of adverse effects can be increased when Muromonab is combined with Altretamine.
AmsacrineThe risk or severity of adverse effects can be increased when Muromonab is combined with Amsacrine.
Additional Data Available
  • Extended Description
    Extended Description
    Available for Purchase

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity
    Available for Purchase

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level
    Available for Purchase

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action
    Available for Purchase

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
Not Available

Products

Purchasing individual compounds or compound libraries for your research?
Learn More
International/Other Brands
Orthoclone OKT3 (Janssen-Cilag)
Brand Name Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing EndRegionImage
Okt3Injection, solution5 mg/5mLIntravenousCentocor Ortho Biotech Products, L.P.1986-07-192011-07-30US flag
Orthoclone Okt 3 Sterile Solution IV 1mg/mlSolutionIntravenousJanssen Pharmaceuticals1987-12-312007-07-09Canada flag
Additional Data Available
  • Application Number
    Application Number
    Available for Purchase

    A unique ID assigned by the FDA when a product is submitted for approval by the labeller.

    Learn more
  • Product Code
    Product Code
    Available for Purchase

    A governmentally-recognized ID which uniquely identifies the product within its regulatory market.

    Learn more

Categories

ATC Codes
L04AA02 — Muromonab-cd3
Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Chemical Identifiers

UNII
JGA39ICE2V
CAS number
140608-64-6

References

General References
Not Available
KEGG Drug
D05092
PubChem Substance
46507837
RxNav
42405
ChEMBL
CHEMBL1201608
Therapeutic Targets Database
DAP001301
PharmGKB
PA164743097
Wikipedia
Muromonab-CD3

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
3Active Not RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / B Acute Lymphoblastic Leukemia, Philadelphia Chromosome Negative1
3Active Not RecruitingTreatmentRecurrent B Acute Lymphoblastic Leukemia1
3CompletedTreatmentType 1 Diabetes Mellitus2
3RecruitingTreatmentB Acute Lymphoblastic Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL11
3RecruitingTreatmentB Acute Lymphoblastic Leukemia / B Lymphoblastic Lymphoma / Down Syndrome (DS)1
2CompletedTreatmentAbdominal wall neoplasm / Fallopian Tube Neoplasms / Ovarian Cancer1
2CompletedTreatmentAcute Myeloid Leukemia (AML) / Hemoglobinuria, Paroxysmal Nocturnal (PNH) / Juvenile Myelomonocytic Leukemia (JMML) / Leukemia, Acute Lymphocytic (ALL) / Leukemia, Myeloid, Chronic(CML) / Lymphoma, Hodgkins / Myelodysplastic Syndromes (MDS) / Non-Hodgkin's Lymphoma (NHL)1
2CompletedTreatmentBrain and Central Nervous System Tumors1
2CompletedTreatmentGiant Cell Myocarditis / Myocarditis1
2CompletedTreatmentMalignant Melanoma of Skin / Melanoma (Skin)1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
  • Centocor Ortho Biotech Inc.
Dosage Forms
FormRouteStrength
Injection, solutionIntravenous5 mg/5mL
SolutionIntravenous
Injection, solutionIntravenous1 mg/1mL
Prices
Unit descriptionCostUnit
Orthoclone okt-3 5 mg/5 ml261.75USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Not Available

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.513Not Available
isoelectric point8.31Not Available

Targets

Kind
Protein
Organism
Humans
Pharmacological action
Yes
General Function
Transmembrane signaling receptor activity
Specific Function
The CD3 complex mediates signal transduction.
Gene Name
CD3D
Uniprot ID
P04234
Uniprot Name
T-cell surface glycoprotein CD3 delta chain
Molecular Weight
18929.38 Da
References
  1. Todd PA, Brogden RN: Muromonab CD3. A review of its pharmacology and therapeutic potential. Drugs. 1989 Jun;37(6):871-99. [PubMed:2503348]
  2. Wilde MI, Goa KL: Muromonab CD3: a reappraisal of its pharmacology and use as prophylaxis of solid organ transplant rejection. Drugs. 1996 May;51(5):865-94. [PubMed:8861551]
Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Binder
General Function
Transmembrane signaling receptor activity
Specific Function
The CD3 complex mediates signal transduction, resulting in T cell activation and proliferation. Required for normal immune responses (PubMed:15546002, PubMed:8490660).
Gene Name
CD3E
Uniprot ID
P07766
Uniprot Name
T-cell surface glycoprotein CD3 epsilon chain
Molecular Weight
23147.09 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
  3. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
Kind
Protein
Organism
Humans
Pharmacological action
Yes
General Function
Transmembrane signaling receptor activity
Specific Function
The CD3 complex mediates signal transduction.
Gene Name
CD3G
Uniprot ID
P09693
Uniprot Name
T-cell surface glycoprotein CD3 gamma chain
Molecular Weight
20469.335 Da
References
  1. Todd PA, Brogden RN: Muromonab CD3. A review of its pharmacology and therapeutic potential. Drugs. 1989 Jun;37(6):871-99. [PubMed:2503348]
  2. Wilde MI, Goa KL: Muromonab CD3: a reappraisal of its pharmacology and use as prophylaxis of solid organ transplant rejection. Drugs. 1996 May;51(5):865-94. [PubMed:8861551]
Kind
Protein
Organism
Humans
Pharmacological action
Yes
General Function
Transmembrane signaling receptor activity
Specific Function
Probable role in assembly and expression of the TCR complex as well as signal transduction upon antigen triggering.
Gene Name
CD247
Uniprot ID
P20963
Uniprot Name
T-cell surface glycoprotein CD3 zeta chain
Molecular Weight
18696.275 Da
References
  1. Todd PA, Brogden RN: Muromonab CD3. A review of its pharmacology and therapeutic potential. Drugs. 1989 Jun;37(6):871-99. [PubMed:2503348]
  2. Wilde MI, Goa KL: Muromonab CD3: a reappraisal of its pharmacology and use as prophylaxis of solid organ transplant rejection. Drugs. 1996 May;51(5):865-94. [PubMed:8861551]
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent...
Gene Name
FCGR3B
Uniprot ID
O75015
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-B
Molecular Weight
26215.64 Da
References
  1. Pellegrini P, Berghella AM, Del Beato T, Adorno D, Casciani CU: Immunological directives for biotherapy improvement in the treatment of colorectal cancer. Cancer Biother Radiopharm. 1996 Apr;11(2):113-8. [PubMed:10851527]
  2. Contasta I, Pellegrini P, Berghella AM, Del Beato T, Canossi A, Di Rocco M, Adorno D, Casciani CU: Necessity of biotherapeutic treatments inducing TH1 cell functions in colorectal cancer. Cancer Biother Radiopharm. 1996 Dec;11(6):373-83. [PubMed:10851498]

Drug created on June 13, 2005 07:24 / Updated on September 03, 2020 18:59

Pbdb medl 2