Explore a selection of our essential drug information below, or:
Identification
- Summary
Digoxin Immune Fab (Ovine) is an antibody binding fragment which binds digoxin molecules which is used as an antidote to digoxin overdose.
- Brand Names
- Digifab
- Generic Name
- Digoxin Immune Fab (Ovine)
- DrugBank Accession Number
- DB00076
- Background
Digoxin Immune Fab is a sheep antibody (26-10) FAB fragment from sheep immunized with the digoxin derivative Digoxindicarboxymethylamine. It is used as an antidote for overdose of digoxin.
- Type
- Biotech
- Groups
- Approved
- Biologic Classification
- Protein Based Therapies
Monoclonal antibody (mAb) - Protein Structure
- Protein Chemical Formula
- C2085H3223N553O672S16
- Protein Average Weight
- 47301.7 Da
- Sequences
>26-10 Heavy chain (murine) EVQLQQSGPELVKPGASVRMSCKSSGYIFTDFYMNWVRQSHGKSLDYIGYISPYSGVTGY NQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCAGSSGNKWAMDYWGHGASVTVSSA KTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
>26-10 Light chain (murine) DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLNWYLQKAGQSPKLLIYKVSNRF SGVPDRFSGSGSGTDFTLKISRVEAEDLGIYFCSQTTHVPPTFGGGTKLEIKRADAAPTV SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Download FASTA Format- Synonyms
- Digitalis antitoxin
- Digoxin Immune Fab, Ovine
- Digoxin-specific Antibody Fragments
- Ovine digoxin immune fab
Pharmacology
- Indication
For treatment of digitoxin overdose or digitalis glycoside toxicity.
Reduce drug development failure ratesBuild, train, & validate machine-learning modelswith evidence-based and structured datasets.Build, train, & validate predictive machine-learning models with structured datasets.- Associated Conditions
Indication Type Indication Combined Product Details Approval Level Age Group Patient Characteristics Dose Form Treatment of Digoxin toxicity •••••••••••• ••••••••• Reversal of Digoxin overdose •••••••••••• ••••••••• - Contraindications & Blackbox Warnings
Prevent Adverse Drug Events TodayTap into our Clinical API for life-saving information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.Avoid life-threatening adverse drug events with our Clinical API- Pharmacodynamics
DigiFab binds molecules of digoxin, making them unavailable for binding at their site of action on cells in the body. The Fab fragment-digoxin complex accumulates in the blood, from which it is excreted by the kidney. The net effect is to shift the equilibrium away from binding of digoxin to its receptors in the body, thereby reversing its effects.
- Mechanism of action
Binds excess digoxin or digitoxin molecules circulating in the blood.
Target Actions Organism ADigoxin other/unknownHumans - Absorption
Not Available
- Volume of distribution
- 0.3 L/kg [DigiFab]
- 0.4 L/kg [Digibind]
- Protein binding
Not Available
- Metabolism
- Not Available
- Route of elimination
Cumulative urinary excretion of digoxin was comparable for both products and exceeded 40% of the administered dose by 24 hours.
- Half-life
15-20 hrs
- Clearance
Not Available
- Adverse Effects
Improve decision support & research outcomesWith structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates. View sample adverse effects data in our new Data Library!Improve decision support & research outcomes with our structured adverse effects data.- Toxicity
Not Available
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRs
- Not Available
Interactions
- Drug Interactions
- This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
Drug Interaction Integrate drug-drug
interactions in your softwareAbciximab The risk or severity of adverse effects can be increased when Abciximab is combined with Digoxin Immune Fab (Ovine). Adalimumab The risk or severity of adverse effects can be increased when Adalimumab is combined with Digoxin Immune Fab (Ovine). Aducanumab The risk or severity of adverse effects can be increased when Digoxin Immune Fab (Ovine) is combined with Aducanumab. Alemtuzumab The risk or severity of adverse effects can be increased when Digoxin Immune Fab (Ovine) is combined with Alemtuzumab. Alirocumab The risk or severity of adverse effects can be increased when Digoxin Immune Fab (Ovine) is combined with Alirocumab. - Food Interactions
- No interactions found.
Products
Drug product information from 10+ global regionsOur datasets provide approved product information including:dosage, form, labeller, route of administration, and marketing period.Access drug product information from over 10 global regions.- Active Moieties
Name Kind UNII CAS InChI Key Digoxin unknown 73K4184T59 20830-75-5 LTMHDMANZUZIPE-PUGKRICDSA-N - Brand Name Prescription Products
Name Dosage Strength Route Labeller Marketing Start Marketing End Region Image Digibind Powder, for solution 38 mg / vial Intravenous Glaxosmithkline Inc 1995-12-31 2013-02-06 Canada 
Digibind Injection, powder, for solution 38 mg/1 Intravenous Glaxosmithkline Inc 1986-07-14 2013-01-31 US 
DigiFab Injection, powder, for solution 40 mg/1 Intravenous BTG International Inc. 2001-08-31 Not applicable US DigiFab Powder, for solution 40 mg / vial Intravenous Btg International Inc 2011-11-04 Not applicable Canada DigiFab Injection, powder, lyophilized, for solution 38 mg/1 Intravenous Savage Laboratories a division of Fougera Pharmaceuticals Inc. 2001-08-31 2014-08-31 US
Categories
- ATC Codes
- V03AB24 — Digitalis antitoxin
- Drug Categories
- Chemical TaxonomyProvided by Classyfire
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
- Affected organisms
- Humans and other mammals
Chemical Identifiers
- UNII
- YB12NQZ1YN
- CAS number
- Not Available
References
- General References
- Not Available
- External Links
- PubChem Substance
- 46506432
- 1745257
- PharmGKB
- PA164769030
- RxList
- RxList Drug Page
- Drugs.com
- Drugs.com Drug Page
- Wikipedia
- Digoxin_Immune_Fab
Clinical Trials
- Clinical Trials
Clinical Trial & Rare Diseases Add-on Data Package
Explore 4,000+ rare diseases, orphan drugs & condition pairs, clinical trial why stopped data, & more. Preview package Phase Status Purpose Conditions Count Start Date Why Stopped 100+ additional columns Unlock 175K+ rows when you subscribe.View sample data4 Completed Prevention Acute Kidney Injury (AKI) 1 somestatus stop reason just information to hide 4 Unknown Status Treatment Hemodialysis Treatment / Hypertension 1 somestatus stop reason just information to hide 2 Completed Treatment Bipolar Disorder (BD) 1 somestatus stop reason just information to hide 2 Completed Treatment Pre-Eclampsia 1 somestatus stop reason just information to hide 2, 3 Terminated Treatment Pre-Eclampsia, Severe 1 somestatus stop reason just information to hide
Pharmacoeconomics
- Manufacturers
- Not Available
- Packagers
- GlaxoSmithKline Inc.
- Savage Labs
- Dosage Forms
Form Route Strength Injection, powder, for solution Intravenous 38 mg/1 Powder, for solution Intravenous 38 mg / vial Injection, powder, for solution Intravenous 40 mg/1 Injection, powder, lyophilized, for solution Intravenous 38 mg/1 Powder, for solution Intravenous 40 mg / vial - Prices
Unit description Cost Unit Digibind 38 mg vial 727.91USD vial Digifab 40 mg vial 615.6USD vial DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.- Patents
- Not Available
Properties
- State
- Liquid
- Experimental Properties
Property Value Source melting point (°C) 61 °C (FAB fragment) Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000) hydrophobicity -0.343 Not Available isoelectric point 8.01 Not Available
Targets
Build, predict & validate machine-learning models
Use our structured and evidence-based datasets to unlock newinsights and accelerate drug research.
Use our structured and evidence-based datasets to unlock new insights and accelerate drug research.
Yes
Other/unknown
References
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [Article]
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [Article]
- McMillin GA, Owen WE, Lambert TL, De BK, Frank EL, Bach PR, Annesley TM, Roberts WL: Comparable effects of DIGIBIND and DigiFab in thirteen digoxin immunoassays. Clin Chem. 2002 Sep;48(9):1580-4. [Article]
- Chhatre S, Thillaivinayagalingam P, Francis R, Titchener-Hooker NJ, Newcombe AR, Keshavarz-Moore E: Decision-support software for the industrial-scale chromatographic purification of antibodies. Biotechnol Prog. 2007 Jul-Aug;23(4):888-94. Epub 2007 Jul 13. [Article]
- Thillaivinayagalingam P, Newcombe AR, O'Donovan K, Francis R, Keshavarz-Moore E: Detection and quantification of affinity ligand leaching and specific antibody fragment concentration within chromatographic fractions using surface plasmon resonance. Biotechnol Appl Biochem. 2007 Dec;48(Pt 4):179-88. [Article]
- Betten DP, Vohra RB, Cook MD, Matteucci MJ, Clark RF: Antidote use in the critically ill poisoned patient. J Intensive Care Med. 2006 Sep-Oct;21(5):255-77. [Article]
Drug created at June 13, 2005 13:24 / Updated at October 07, 2024 13:58