Chorionic Gonadotropin (Human)
Identification
- Name
- Chorionic Gonadotropin (Human)
- Accession Number
- DB09126
- Description
Human chorionic gonadotropin (HCG), a polypeptide hormone produced by the human placenta. Endogenously produced HCG interacts with the LHCG receptor of the ovary and promotes the maintenance of the corpus luteum during the beginning of pregnancy. This allows the corpus luteum to continuously secrete the hormone progesterone during the first trimester, which is required for maintenance of the uterus and prevents menstruation. In males, HCG also stimulates the production of gonadal steroid hormones by stimulating the interstitial cells (Leydig cells) of the testis to produce androgens.
HCG is composed of an alpha and a beta sub-unit. The alpha sub-unit is essentially identical to the alpha sub units of the human pituitary gonadotropins, luteinizing hormone (LH) and follicle-stimulating hormone (FSH), as well as to the alpha sub-unit of human thyroid-stimulating hormone (TSH), while the beta sub units of these hormones differ in amino acid sequence. As a drug product, chorionic gonadotropin is a highly purified pyrogen-free preparation obtained from the urine of pregnant females.
- Type
- Biotech
- Groups
- Approved, Vet approved
- Biologic Classification
- Protein Based Therapies
Hormones - Protein Structure
- Protein Chemical Formula
- Not Available
- Protein Average Weight
- Not Available
- Sequences
>Alpha Chain APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
>Beta Chain SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYR DVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSS SKAPPPSLPSPSRLPGPSDTPILPQ
Download FASTA Format- Synonyms
- Chorionic gonadotrophin
- Chorionic gonadotropin
- Gonadotropin, Chorionic
- Gonadotropin,chorionic
- h-HCG
- hCG
- Human chorionic gonadotropin
- Human menopausal gonadotropin
- Human menopausal gonadotropin (urine derived)
- Human-chorionic gonadotropin
- Urinary hCG
Pharmacology
- Indication
For the treatment of prepubertal cryptorchidism (not due to anatomical obstruction), for the treatment of selected cases of hypogonadotropic hypogonadism (hypogonadism secondary to a pituitary deficiency) in males and for the induction of ovulation and pregnancy in the anovulatory, infertile woman in whom the cause of anovulation is secondary and not due to primary ovarian failure, and who has been appropriately pretreated with human menotropins.
- Associated Conditions
- Associated Therapies
- Contraindications & Blackbox Warnings
Learn about our commercial Contraindications & Blackbox Warnings data.
Learn More- Pharmacodynamics
The action of HCG is virtually identical to that of pituitary LH, although HCG appears to have a small degree of FSH activity as well. It stimulates production of gonadal steroid hormones by stimulating the interstitial cells (Leydig cells) of the testis to produce androgens and the corpus luteum of the ovary to produce progesterone.
- Mechanism of action
Target Actions Organism ALutropin-choriogonadotropic hormone receptor ligandHumans - Absorption
- Not Available
- Volume of distribution
- Not Available
- Protein binding
- Not Available
- Metabolism
- Not Available
- Route of elimination
- Not Available
- Half-life
- Not Available
- Clearance
- Not Available
- Adverse Effects
Learn about our commercial Adverse Effects data.
Learn More- Toxicity
- Not Available
- Affected organisms
- Not Available
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRs
- Not Available
Interactions
- Drug Interactions
- This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.Not Available
- Food Interactions
- Not Available
Products
- Brand Name Prescription Products
Name Dosage Strength Route Labeller Marketing Start Marketing End Region Image Unlock Additional DataApl Inj 1000 Iu/ml Liquid Intramuscular Ayerst Laboratories 1951-12-31 2000-08-02 Canada 
Chorionic Gonadotropin for Injection, USP Powder, for solution Intramuscular; Subcutaneous Fresenius Kabi 2004-09-13 Not applicable Canada Novarel 5000 [USP'U]/1 Intramuscular Ferring Pharmaceuticals Inc. 2017-08-30 Not applicable US 
Novarel 10000 [USP'U]/1 Intramuscular Ferring Pharmaceuticals Inc. 1974-01-15 Not applicable US Profasi Hp Inj 10000unit/vial USP Powder, for solution Intramuscular Pharmascience Inc 1984-12-31 2009-04-29 Canada Additional Data Available- Application NumberApplication NumberAvailable for Purchase
A unique ID assigned by the FDA when a product is submitted for approval by the labeller.
Learn more - Product CodeProduct CodeAvailable for Purchase
A governmentally-recognized ID which uniquely identifies the product within its regulatory market.
Learn more
- Mixture Products
Name Ingredients Dosage Route Labeller Marketing Start Marketing End Region Image A.P.L. - Pws-liq Chorionic Gonadotropin (Human) (10000 unit) + Water (10 ml) Liquid; Powder, for solution Intramuscular Wyeth Ayerst Canada Inc. 1998-11-11 2001-06-01 Canada Pregnyl Chorionic Gonadotropin (Human) (10000 unit) + Water (10 ml) Kit; Liquid; Powder, for solution Intramuscular Merck Ltd. 1997-08-13 Not applicable Canada Profasi Hp 10000 Chorionic Gonadotropin (Human) (10000 unit) + Water (10 ml) Kit; Liquid; Powder, for solution Intramuscular; Subcutaneous Emd Serono, A Division Of Emd Inc., Canada 1991-12-31 2007-05-07 Canada
Categories
- ATC Codes
- G03GA01 — Chorionic gonadotrophin
- Drug Categories
- Amino Acids, Peptides, and Proteins
- Chorionic Gonadotropin
- Genito Urinary System and Sex Hormones
- Gonadotropins
- Gonadotropins and Antigonadotropins
- Hormones
- Hormones, Hormone Substitutes, and Hormone Antagonists
- Peptide Hormones
- Peptides
- Placental Hormones
- Pregnancy Proteins
- Proteins
- Reproductive Control Agents
- Sex Hormones and Modulators of the Genital System
- Chemical TaxonomyProvided by Classyfire
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
Chemical Identifiers
- UNII
- 20ED16GHEB
- CAS number
- 9002-61-3
References
- General References
- Not Available
- External Links
- KEGG Drug
- D06457
- PubChem Substance
- 347910414
- 340705
- ChEBI
- 81570
- ChEMBL
- CHEMBL1201509
- RxList
- RxList Drug Page
- Drugs.com
- Drugs.com Drug Page
- Wikipedia
- Human_chorionic_gonadotropin
- AHFS Codes
- 68:18.00 — Gonadotropins and Antigonadotropins
- FDA label
- Download (26.7 KB)
Clinical Trials
- Clinical Trials
Phase Status Purpose Conditions Count 4 Completed Basic Science Controlled Ovarian Stimulation / Infertility 1 4 Completed Basic Science Infertility / Subfertility 1 4 Completed Health Services Research Female Infertility 1 4 Completed Treatment Assisted Reproduction 1 4 Completed Treatment Fertility / Optimal Stimulation Protocol / Reproductive Endocrinology 1 4 Completed Treatment Idiopathic Hypogonadotropic Hypogonadism 1 4 Completed Treatment Idiopathic Hypogonadotropic Hypogonadism / Olfacto genital dysplasia 1 4 Completed Treatment Infertile Women Undergoing Assisted Reproductive Technology (ART) 1 4 Completed Treatment Infertility 11 4 Completed Treatment OHSS (Ovarian Hyperstimulation) 1
Pharmacoeconomics
- Manufacturers
- Not Available
- Packagers
- Not Available
- Dosage Forms
Form Route Strength Liquid; powder, for solution Intramuscular Liquid Intramuscular Powder Parenteral 1500 IU/1 Powder Parenteral 5000 IU/1 Injection, solution Intramuscular 5000 iu Injection Parenteral 2000 iu Injection Parenteral 5000 iu Injection, powder, for solution Parenteral 5000 IU Powder, for solution Intramuscular; Subcutaneous Injection, powder, for solution 1000 UI/1ML Injection, powder, for solution 2000 UI/1ML Injection, powder, for solution 250 UI/1ML Injection, powder, for solution 5000 UI/1ML Injection, powder, for solution Subcutaneous 1000 U.I./1ML Injection, powder, for solution Subcutaneous 1000 U.I./2ML Injection, powder, for solution Subcutaneous 10000 U.I./1ML Injection, powder, for solution Subcutaneous 125 U.I./1ML Injection, powder, for solution Subcutaneous 125 U.I./2ML Injection, powder, for solution Subcutaneous 2000 U.I./1ML Injection, powder, for solution Subcutaneous 2000 U.I./2ML Injection, powder, for solution Subcutaneous 250 U.I./1ML Injection, powder, for solution Subcutaneous 250 U.I./2ML Injection, powder, for solution Subcutaneous 500 U.I./2ML Injection, powder, for solution Subcutaneous 500 U.I./1ML Injection, powder, for solution Subcutaneous 5000 U.I./2ML Injection, powder, for solution Subcutaneous 5000 U.I./1ML Injection, powder, for solution 10000 iu Injection, powder, for solution 2000 iu Injection, powder, lyophilized, for solution Parenteral 5000 IU Powder Not applicable 1 g/1g Injection, powder, for solution 1000 iu Injection, powder, for solution 5000 iu Injection, powder, for solution 150 iu Injection, powder, for solution 75 iu Injection, powder, for solution 600 iu Injection, powder, for solution 1200 iu Injection, powder, lyophilized, for solution Intramuscular; Subcutaneous 75 IU Injection Parenteral 250 MCG/0.5ML Powder Parenteral Injection, powder, for solution 1500 iu Injection, powder, for solution 5000 UI Injection, powder, for solution Intramuscular 1500 UI Injection, powder, for solution Intramuscular 5000 UI Kit; liquid; powder, for solution Intramuscular Injection, powder, lyophilized, for solution Intramuscular; Subcutaneous 1500 iu Injection, powder, for solution Intramuscular 5000 IU Injection, powder, lyophilized, for solution Intramuscular; Subcutaneous 5000 iu Powder Parenteral 5000 IE Injection, powder, for solution Subcutaneous 1000 U.I. Injection, powder, for solution Subcutaneous 2000 U.I. Injection, powder, for solution Subcutaneous 250 U.I. Injection, powder, for solution Subcutaneous 500 U.I. Injection, powder, for solution Subcutaneous 5000 U.I. Kit; liquid; powder, for solution Intramuscular; Subcutaneous Powder, for solution Intramuscular Injection, powder, lyophilized, for solution Intramuscular; Subcutaneous 1000 IU Injection Parenteral 10000 IU Injection Parenteral 7500 IU - Prices
- Not Available
- Patents
Patent Number Pediatric Extension Approved Expires (estimated) Region Unlock Additional DataUS6706681 No 2004-03-16 2021-03-16 US Additional Data Available- Filed OnFiled OnAvailable for Purchase
The date on which a patent was filed with the relevant government.
Learn more
Properties
- State
- Solid
- Experimental Properties
- Not Available
Targets
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- Actions
- Ligand
- General Function
- Luteinizing hormone receptor activity
- Specific Function
- Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
- Gene Name
- LHCGR
- Uniprot ID
- P22888
- Uniprot Name
- Lutropin-choriogonadotropic hormone receptor
- Molecular Weight
- 78642.01 Da
Drug created on September 23, 2015 10:50 / Updated on January 23, 2021 21:03