Chorionic Gonadotropin (Human)

Identification

Name
Chorionic Gonadotropin (Human)
Accession Number
DB09126
Description

Human chorionic gonadotropin (HCG), a polypeptide hormone produced by the human placenta. Endogenously produced HCG interacts with the LHCG receptor of the ovary and promotes the maintenance of the corpus luteum during the beginning of pregnancy. This allows the corpus luteum to continuously secrete the hormone progesterone during the first trimester, which is required for maintenance of the uterus and prevents menstruation. In males, HCG also stimulates the production of gonadal steroid hormones by stimulating the interstitial cells (Leydig cells) of the testis to produce androgens.

HCG is composed of an alpha and a beta sub-unit. The alpha sub-unit is essentially identical to the alpha subĀ­ units of the human pituitary gonadotropins, luteinizing hormone (LH) and follicle-stimulating hormone (FSH), as well as to the alpha sub-unit of human thyroid-stimulating hormone (TSH), while the beta subĀ­ units of these hormones differ in amino acid sequence. As a drug product, chorionic gonadotropin is a highly purified pyrogen-free preparation obtained from the urine of pregnant females.

Type
Biotech
Groups
Approved, Vet approved
Biologic Classification
Protein Based Therapies
Hormones
Protein Structure
Db09126
Protein Chemical Formula
Not Available
Protein Average Weight
Not Available
Sequences
>Alpha Chain
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC
VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
>Beta Chain
SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYR
DVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSS
SKAPPPSLPSPSRLPGPSDTPILPQ
Download FASTA Format
Synonyms
  • Chorionic gonadotrophin
  • Chorionic gonadotropin
  • Gonadotropin, Chorionic
  • Gonadotropin,chorionic
  • h-HCG
  • hCG
  • Human chorionic gonadotropin
  • Human menopausal gonadotropin
  • Human menopausal gonadotropin (urine derived)
  • Human-chorionic gonadotropin
  • Urinary hCG

Pharmacology

Indication

For the treatment of prepubertal cryptorchidism (not due to anatomical obstruction), for the treatment of selected cases of hypogonadotropic hypogonadism (hypogonadism secondary to a pituitary deficiency) in males and for the induction of ovulation and pregnancy in the anovulatory, infertile woman in whom the cause of anovulation is secondary and not due to primary ovarian failure, and who has been appropriately pretreated with human menotropins.

Associated Conditions
Associated Therapies
Contraindications & Blackbox Warnings
Learn about our commercial Contraindications & Blackbox Warnings data.
Learn More
Pharmacodynamics

The action of HCG is virtually identical to that of pituitary LH, although HCG appears to have a small degree of FSH activity as well. It stimulates production of gonadal steroid hormones by stimulating the interstitial cells (Leydig cells) of the testis to produce androgens and the corpus luteum of the ovary to produce progesterone.

Mechanism of action
TargetActionsOrganism
ALutropin-choriogonadotropic hormone receptor
ligand
Humans
Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half-life
Not Available
Clearance
Not Available
Adverse Effects
Learn about our commercial Adverse Effects data.
Learn More
Toxicity
Not Available
Affected organisms
Not Available
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
Not Available
Food Interactions
Not Available

Products

Purchasing individual compounds or compound libraries for your research?
Learn More
Brand Name Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing EndRegionImage
Apl Inj 1000 Iu/mlLiquidIntramuscularAyerst Laboratories1951-12-312000-08-02Canada flag
Chorionic Gonadotropin for Injection, USPPowder, for solutionIntramuscular; SubcutaneousFresenius Kabi2004-09-13Not applicableCanada flag
Novarel10000 [USP'U]/1IntramuscularFerring Pharmaceuticals Inc.1974-01-15Not applicableUS flag
Novarel5000 [USP'U]/1IntramuscularFerring Pharmaceuticals Inc.2017-08-30Not applicableUS flag
Profasi Hp Inj 10000unit/vial USPPowder, for solutionIntramuscularPharmascience Inc1984-12-312009-04-29Canada flag
Additional Data Available
  • Application Number
    Application Number
    Available for Purchase

    A unique ID assigned by the FDA when a product is submitted for approval by the labeller.

    Learn more
  • Product Code
    Product Code
    Available for Purchase

    A governmentally-recognized ID which uniquely identifies the product within its regulatory market.

    Learn more
Mixture Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing EndRegionImage
A.P.L. - Pws-liqChorionic Gonadotropin (Human) (10000 unit) + Water (10 ml)Liquid; Powder, for solutionIntramuscularWyeth Ayerst Canada Inc.1998-11-112001-06-01Canada flag
PregnylChorionic Gonadotropin (Human) (10000 unit) + Water (10 ml)Kit; Liquid; Powder, for solutionIntramuscularMerck Ltd.1997-08-13Not applicableCanada flag
Profasi Hp 10000Chorionic Gonadotropin (Human) (10000 unit) + Water (10 ml)Kit; Liquid; Powder, for solutionIntramuscular; SubcutaneousEmd Serono, A Division Of Emd Inc., Canada1991-12-312007-05-07Canada flag

Categories

ATC Codes
G03GA01 — Chorionic gonadotrophin
Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Chemical Identifiers

UNII
20ED16GHEB
CAS number
9002-61-3

References

General References
Not Available
KEGG Drug
D06457
PubChem Substance
347910414
RxNav
340705
ChEBI
81570
ChEMBL
CHEMBL1201509
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Human_chorionic_gonadotropin
AHFS Codes
  • 68:18.00 — Gonadotropins and Antigonadotropins
FDA label
Download (26.7 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
4CompletedBasic ScienceControlled Ovarian Stimulation / Infertility1
4CompletedBasic ScienceInfertility / Subfertility1
4CompletedHealth Services ResearchFemale Infertility1
4CompletedTreatmentAssisted Reproduction1
4CompletedTreatmentFertility / Optimal Stimulation Protocol / Reproductive Endocrinology1
4CompletedTreatmentIdiopathic Hypogonadotropic Hypogonadism1
4CompletedTreatmentIdiopathic Hypogonadotropic Hypogonadism / Olfacto genital dysplasia1
4CompletedTreatmentInfertile Women Undergoing Assisted Reproductive Technology (ART)1
4CompletedTreatmentInfertility11
4CompletedTreatmentInfertility Indicated for ICSI1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage Forms
FormRouteStrength
Liquid; powder, for solutionIntramuscular
LiquidIntramuscular
PowderParenteral1500 IU/1
PowderParenteral5000 IU/1
Injection, solutionIntramuscular5000 iu
InjectionParenteral2000 iu
InjectionParenteral5000 iu
Injection, powder, for solutionParenteral5000 IU
Powder, for solutionIntramuscular; Subcutaneous
Injection, powder, for solution10000 iu
Injection, powder, for solution2000 iu
Injection, powder, lyophilized, for solutionParenteral5000 IU
PowderNot applicable1 g/1g
Injection, powder, for solution1000 iu
Injection, powder, for solution5000 iu
Injection, powder, for solution150 iu
Injection, powder, for solution75 iu
Injection, powder, for solution600 iu
Injection, powder, for solution1200 iu
Injection, powder, lyophilized, for solutionIntramuscular; Subcutaneous75 IU
InjectionParenteral250 MCG/0.5ML
PowderParenteral
Injection, powder, for solution1500 iu
Kit; liquid; powder, for solutionIntramuscular
Injection, powder, lyophilized, for solutionIntramuscular; Subcutaneous1500 iu
Injection, powder, for solutionIntramuscular5000 IU
PowderParenteral5000 IE
Injection, powder, lyophilized, for solutionIntramuscular; Subcutaneous5000 IU
Kit; liquid; powder, for solutionIntramuscular; Subcutaneous
Powder, for solutionIntramuscular
Injection, powder, lyophilized, for solutionIntramuscular; Subcutaneous1000 IU
InjectionParenteral10000 IU
InjectionParenteral7500 IU
Prices
Not Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)Region
US6706681No2004-03-162021-03-16US flag
Additional Data Available
  • Filed On
    Filed On
    Available for Purchase

    The date on which a patent was filed with the relevant government.

    Learn more

Properties

State
Solid
Experimental Properties
Not Available

Targets

Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Ligand
General Function
Luteinizing hormone receptor activity
Specific Function
Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
Gene Name
LHCGR
Uniprot ID
P22888
Uniprot Name
Lutropin-choriogonadotropic hormone receptor
Molecular Weight
78642.01 Da

Drug created on September 23, 2015 10:50 / Updated on November 25, 2020 08:53

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Logo pink
Stay in the know!
As part of our commitment to providing the most up-to-date drug information, we will be releasing #DrugBankUpdates with our newly added curated drug pages.
#DrugBankUpdates