Identification

Summary

Chorionic Gonadotropin (Human) is a naturally-occurring hormone produced during human placenta used for the treatment of prepubertal cryptorchidism and hypogonadotropic hypogonadism in selected males, and induction of pregnancy in selected infertile women.

Brand Names
Novarel, Pregnyl
Generic Name
Chorionic Gonadotropin (Human)
DrugBank Accession Number
DB09126
Background

Human chorionic gonadotropin (HCG), a polypeptide hormone produced by the human placenta. Endogenously produced HCG interacts with the LHCG receptor of the ovary and promotes the maintenance of the corpus luteum during the beginning of pregnancy. This allows the corpus luteum to continuously secrete the hormone progesterone during the first trimester, which is required for maintenance of the uterus and prevents menstruation. In males, HCG also stimulates the production of gonadal steroid hormones by stimulating the interstitial cells (Leydig cells) of the testis to produce androgens.

HCG is composed of an alpha and a beta sub-unit. The alpha sub-unit is essentially identical to the alpha subĀ­ units of the human pituitary gonadotropins, luteinizing hormone (LH) and follicle-stimulating hormone (FSH), as well as to the alpha sub-unit of human thyroid-stimulating hormone (TSH), while the beta subĀ­ units of these hormones differ in amino acid sequence. As a drug product, chorionic gonadotropin is a highly purified pyrogen-free preparation obtained from the urine of pregnant females.

Type
Biotech
Groups
Approved, Vet approved
Biologic Classification
Protein Based Therapies
Hormones
Protein Structure
Db09126
Protein Chemical Formula
Not Available
Protein Average Weight
Not Available
Sequences
>Alpha Chain
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC
VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
>Beta Chain
SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYR
DVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSS
SKAPPPSLPSPSRLPGPSDTPILPQ
Download FASTA Format
Synonyms
  • Chorionic gonadotrophin
  • Chorionic gonadotropin
  • Gonadotropin, Chorionic
  • Gonadotropin,chorionic
  • h-HCG
  • hCG
  • Human chorionic gonadotropin
  • Human menopausal gonadotropin
  • Human menopausal gonadotropin (urine derived)
  • Human-chorionic gonadotropin
  • Urinary hCG

Pharmacology

Indication

For the treatment of prepubertal cryptorchidism (not due to anatomical obstruction), for the treatment of selected cases of hypogonadotropic hypogonadism (hypogonadism secondary to a pituitary deficiency) in males and for the induction of ovulation and pregnancy in the anovulatory, infertile woman in whom the cause of anovulation is secondary and not due to primary ovarian failure, and who has been appropriately pretreated with human menotropins.

Pharmacology
Reduce drug development failure rates
Build, train, & validate machine-learning models
with evidence-based and structured datasets.
See how
Build, train, & validate predictive machine-learning models with structured datasets.
See how
Associated Conditions
Associated Therapies
Contraindications & Blackbox Warnings
Contraindications
Avoid life-threatening adverse drug events
Improve clinical decision support with information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.
Learn more
Avoid life-threatening adverse drug events & improve clinical decision support.
Learn more
Pharmacodynamics

The action of HCG is virtually identical to that of pituitary LH, although HCG appears to have a small degree of FSH activity as well. It stimulates production of gonadal steroid hormones by stimulating the interstitial cells (Leydig cells) of the testis to produce androgens and the corpus luteum of the ovary to produce progesterone.

Mechanism of action
TargetActionsOrganism
ALutropin-choriogonadotropic hormone receptor
ligand
Humans
Absorption

Not Available

Volume of distribution

Not Available

Protein binding

Not Available

Metabolism
Not Available
Route of elimination

Not Available

Half-life

Not Available

Clearance

Not Available

Adverse Effects
Adverseeffects
Improve decision support & research outcomes
With structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates.
Learn more
Improve decision support & research outcomes with our structured adverse effects data.
Learn more
Toxicity

Not Available

Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
Not Available
Food Interactions
No interactions found.

Products

Products2
Drug product information from 10+ global regions
Our datasets provide approved product information including:
dosage, form, labeller, route of administration, and marketing period.
Access now
Access drug product information from over 10 global regions.
Access now
Brand Name Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing EndRegionImage
Apl Inj 1000 Iu/mlLiquid1000 unit / mLIntramuscularAyerst Laboratories1951-12-312000-08-02Canada flag
Chorionic Gonadotropin for Injection, USPPowder, for solution10000 unit / vialIntramuscular; SubcutaneousFresenius Kabi2004-09-13Not applicableCanada flag
Novarel5000 [USP'U]/1IntramuscularFerring Pharmaceuticals Inc.2017-08-30Not applicableUS flag
Novarel10000 [USP'U]/1IntramuscularFerring Pharmaceuticals Inc.1974-01-15Not applicableUS flag
Profasi Hp Inj 10000unit/vial USPPowder, for solution10000 unit / vialIntramuscularPharmascience Inc1984-12-312009-04-29Canada flag
Mixture Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing EndRegionImage
A.P.L. - Pws-liqChorionic Gonadotropin (Human) (10000 unit / kit) + Water (10 mL / kit)Liquid; Powder, for solutionIntramuscularWyeth Ayerst Canada Inc.1998-11-112001-06-01Canada flag
PregnylChorionic Gonadotropin (Human) (10000 unit) + Water (10 ml)Kit; Liquid; Powder, for solutionIntramuscularMerck Ltd.1997-08-13Not applicableCanada flag
Profasi Hp 10000Chorionic Gonadotropin (Human) (10000 unit / vial) + Water (10 mL / vial)Kit; Liquid; Powder, for solutionIntramuscular; SubcutaneousEmd Serono, A Division Of Emd Inc., Canada1991-12-312007-05-07Canada flag

Categories

ATC Codes
G03GA01 — Chorionic gonadotrophin
Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available
Affected organisms
Not Available

Chemical Identifiers

UNII
20ED16GHEB
CAS number
9002-61-3

References

General References
Not Available
KEGG Drug
D06457
PubChem Substance
347910414
RxNav
340705
ChEBI
81570
ChEMBL
CHEMBL1201509
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Human_chorionic_gonadotropin
FDA label
Download (26.7 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
4CompletedBasic ScienceControlled Ovarian Stimulation / Infertility1
4CompletedBasic ScienceInfertility / Subfertility1
4CompletedHealth Services ResearchFemale Infertility1
4CompletedTreatmentAssisted Reproduction1
4CompletedTreatmentFertility / Optimal Stimulation Protocol / Reproductive Endocrinology1
4CompletedTreatmentIdiopathic Hypogonadotropic Hypogonadism1
4CompletedTreatmentIdiopathic Hypogonadotropic Hypogonadism / Olfacto genital dysplasia1
4CompletedTreatmentInfertile Women Undergoing Assisted Reproductive Technology (ART)1
4CompletedTreatmentInfertility11
4CompletedTreatmentOHSS (Ovarian Hyperstimulation)1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage Forms
FormRouteStrength
Liquid; powder, for solutionIntramuscular
LiquidIntramuscular1000 unit / mL
PowderParenteral1500 IU/1
PowderParenteral5000 IU/1
Injection, solutionIntramuscular
Injection, powder, for solutionParenteral
Powder, for solutionIntramuscular; Subcutaneous10000 unit / vial
Injection, powder, for solution
Injection, powder, lyophilized, for solutionParenteral
PowderNot applicable1 g/1g
Injection, powder, lyophilized, for solutionIntramuscular; Subcutaneous75 IU
InjectionParenteral
Kit; liquid; powder, for solutionIntramuscular
Injection, powder, lyophilized, for solutionIntramuscular; Subcutaneous
Injection, powder, for solutionIntramuscular
Injection, powder, for solutionIntramuscular; Subcutaneous5000 iu
PowderParenteral5000 IE
Injection, powder, lyophilized, for solutionIntramuscular; Subcutaneous5000 IU
Injection, powder, for solutionSubcutaneous
Kit; liquid; powder, for solutionIntramuscular; Subcutaneous
Powder, for solutionIntramuscular10000 unit / vial
Injection, powder, lyophilized, for solutionIntramuscular; Subcutaneous1000 IU
PowderParenteral5000 iu/1ampoule
PowderParenteral10000 iu/1vial
PowderParenteral2000 iu/1vial
PowderParenteral5000 iu/1vial
Prices
Not Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)Region
US6706681No2004-03-162021-03-16US flag

Properties

State
Solid
Experimental Properties
Not Available

Targets

Drugtargets2
Build, predict & validate machine-learning models
Use our structured and evidence-based datasets to unlock new
insights and accelerate drug research.
Learn more
Use our structured and evidence-based datasets to unlock new insights and accelerate drug research.
Learn more
Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Ligand
General Function
Luteinizing hormone receptor activity
Specific Function
Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
Gene Name
LHCGR
Uniprot ID
P22888
Uniprot Name
Lutropin-choriogonadotropic hormone receptor
Molecular Weight
78642.01 Da

Drug created at September 23, 2015 16:50 / Updated at October 26, 2021 21:40