Dupilumab
Identification
- Summary
Dupilumab is a monoclonal antibody used to treat moderate to severe atopic dermatitis, asthma, and nasal polyps accompanied by chronic rhinosinusitis in adolescents and adults.
- Brand Names
- Dupixent
- Generic Name
- Dupilumab
- DrugBank Accession Number
- DB12159
- Background
Dupilumab is a fully human monoclonal antibody of the immunoglobulin G4 subclass that binds to the interleukin-4 (IL-4) receptor, inhibiting the receptor signaling pathways.3 As an interleukin-4 receptor alpha antagonist, dupilumab inhibits the signaling of pro-inflammatory cytokines, called interleukins (IL), that induce inflammatory and immunological reactions in several atopic or allergic conditions, such as eczema, allergic reaction, and rhinosinusitis.3 Dupilumab was generated by recombinant DNA technology in Chinese Hamster Ovary cell suspension culture.7
Dupilumab is commonly marketed as Dupixent, which is available as a formulation for subcutaneous injection. It was first approved by the FDA in 2017. It is currently used to treat atopic dermatitis, asthma as an add-on maintenance treatment, chronic rhinosinusitis with nasal polyposis, and eosinophilic esophagitis.14 It is used as monotherapy or in combination with other drugs, such as corticosteroids.7,8,13 Dupilumab is currently under investigations for potential therapeutic use in diseases driven by allergic reactions or type 2 inflammation, such as pediatric atopic dermatitis, and chronic obstructive pulmonary disease. It is also being studied in combination with another antibody that which targets IL-33.9
- Type
- Biotech
- Groups
- Approved, Investigational
- Biologic Classification
- Protein Based Therapies
Monoclonal antibody (mAb) - Protein Chemical Formula
- C6512H10066N1730O2052S46
- Protein Average Weight
- 146896.9522 Da
- Sequences
>Dupilumab Heavy Chain EVQLVESGGGLEQPGGSLRLSCAGSGFTFRDYAMTWVRQAPGKGLEWVSSISGSGGNTYY ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDRLSITIRPRYYGLDVWGQGTT VTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA VLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFL GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQ FNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQ EEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKS RWQEGNVFSCSVMHEALHNHYTQKSLSLSLG
>Dupilumab Light Chain DIVMTQSPLSLPVTPGEPASISCRSSQSLLYSIGYNYLDWYLQKSGQSPQLLIYLGSNRA SGVPDRFSGSGSGTDFTLKISRVEAEDVGFYYCMQALQTPYTFGQGTKLEIKRTVAAPSV FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA FormatReferences:
- KEGG DRUG: Dupilumab [Link]
- Synonyms
- Dupilumab
- External IDs
- REGN 668
- REGN-668
- REGN668
- SAR 231893
- SAR-231893
- SAR231893
Pharmacology
- Indication
In the US, dupilumab is indicated for the treatment of patients aged six months and older with moderate-to-severe atopic dermatitis whose disease is not adequately controlled with topical prescription therapies or when those therapies are not advisable.15 In Europe and Canada, the drug for this indication is approved for patients aged six years and older.8,13 In Europe, patients six to 11 years of age should have severe atopic dermatitis and be candidates for systemic therapy.8 Dupilumab can be used with or without topical corticosteroids for this condition.7,13
Dupilumab is indicated as an add-on maintenance treatment of patients aged six years and older with moderate-to-severe asthma characterized by an eosinophilic phenotype or with oral corticosteroid dependent asthma. However, the drug is not indicated for relief of acute bronchospasm or status asthmaticus.7,8,13
Dupilumab is indicated as an add-on maintenance treatment in adult patients with inadequately controlled chronic rhinosinusitis with nasal polyposis.7 In Canada and Europe, it is used with intranasal corticosteroids.8,13
In the US and Europe, dupilumab is also indicated for the treatment of adults and children aged 12 years and older weighing at least 40 kg with eosinophilic esophagitis (EoE), and adults with prurigo nodularis.8,14,16
Reduce drug development failure ratesBuild, train, & validate machine-learning modelswith evidence-based and structured datasets.Build, train, & validate predictive machine-learning models with structured datasets.- Associated Conditions
- Chronic Rhinosinusitis Phenotype With Nasal Polyps (CRSwNP)
- Eosinophilic Esophagitis
- Moderate to Severe Asthma
- Moderate to Severe Atopic Dermatitis
- Oral Steroid-Dependent Asthma (Disorder)
- Prurigo Nodularis
- Severe Asthma
- Severe Atopic Dermatitis
- Moderate Atopic dermatitis
- Moderate Prurigo Nodularis
- Severe Prurigo Nodularis
- Associated Therapies
- Contraindications & Blackbox Warnings
- Avoid life-threatening adverse drug eventsImprove clinical decision support with information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.Avoid life-threatening adverse drug events & improve clinical decision support.
- Pharmacodynamics
Dupilumab is an recombinant human IgG4 antibody to the IL-4 receptor that works by inhibiting the activation of certain pro-inflammatory cytokines that are implicated in the pathophysiology of several allergic and atopic conditions, including asthma, chronic rhinosinusitis with nasal polyps, and food and environmental allergies. In vivo, dupilumab was shown to reduce the levels of type 2 inflammatory biomarkers associated with atopic dermatitis, such as thymus and activation-regulated chemokine (TARC/CCL17), total serum IgE, allergen-specific IgE, and lactate dehydrogenase (LDH). A decrease in the levels of biomarkers of asthma, such as FeNO, eotaxin-3, IgE, periostin, and eotaxin-3 (CCL26) was also observed.8,9 Since dupilumab works to suppress the immune response, it is proposed that it may influence the immune response against some infections, such as helminth infections, by inhibiting IL-4/IL-13 signaling. It is advised that infections are appropriately treated until resolved before initiating dupilumab therapy.8
While findings of some in vitro and in vivo studies suggest that some cytokine modulators may influence the expression and activity of specific cytochrome P450 (CYP450) enzymes, an open-label drug-drug interaction study demonstrated that dupilumab displays no significant effect on the activity of CYP450 enzymes studied (CYP3A, CYP2C19, CYP2C9, CYP1A2, and CYP2D6).5
- Mechanism of action
Type 2 inflammatory processes in various allergic and atopic conditions, such as asthma and atopic diseases, involve the type 2 helper T-cell (Th2) immunity.4 Upregulation of this Type 2/Th2 pathway is commonly observed in other inflammatory conditions 5 and the activation of Th2 cells is linked to the production of Th2-associated cytokines, such as interleukin (IL) 4, IL-5, IL-9, and IL-13.4 IL-4 and IL-13 play a central role in inducing inflammatory conditions such as allergic rhinitis, asthma, and atopic dermatitis,9 by regulating Type 2 inflammation and immune function. These inflammatory cytokines work by modulating gene expression downstream of receptor signalling,5 regulating Th2 cell differentiation, and activating inflammatory cells such as mast cells and macrophages.6
There are two types of receptors for IL-4: the type 1 receptor, which is composed of the IL-4 chain (IL-4Rα) and a γ chain (γC), and the type 2 receptor, which is composed of the IL-4Rα chain and the α1 chain of the IL-13 receptor (IL-13Rα1).4 Essentially, IL‐4Rα is a component shared by the IL‐4 and IL-13 receptor complexes 3 and is ubiquitously expressed on both innate and adaptive immune cells to promote the signaling of IL-4 and IL-13.6 The type I receptor is primarily expressed on lymphocytes and controls Th2-cell differentiation, whereas the type II receptor is mostly found across resident and myeloid cells.1 Dupilumab is a fully human monoclonal antibody directed against IL‐4Rα to inhibit the signalling of IL‐4 and IL‐13.5 Dupilumab inhibits IL-4 signalling via the Type I receptor (IL-4Rα/γc), and both IL-4 and IL-13 signaling through the Type II receptor (IL-4Rα/IL-13Rα).8 It ultimately downregulates type-2 immunity.4
Target Actions Organism AInterleukin-4 receptor subunit alpha inhibitorantibodyHumans AInterleukin-13 inhibitorantibodyHumans AInterleukin-4 inhibitorantibodyHumans - Absorption
The Cmax following administration of a single subcutaneous dose of 600 mg or 400 mg of dupilumab were 70.1 ± 24.1 mcg/mL or 41.8 ± 12.4 mcg/mL, respectively. The Tmax ranged from 3 to 7 days following administration of a single subcutaneous dose ranging from 75 to 600 mg.7 Following a subcutaneous dose, the absolute bioavailability of dupilumab ranged between 61% and 64% in patients with atopic dermatitis or asthma.8
In clinical trials, the steady-state concentrations were reached by week 16 following the administration of 600 mg starting dose and 300 mg dose every other week. At these concentrations, the mean trough concentrations ranged from 60.3 ± 35.1 mcg/mL to 79.9 ± 41.4 mcg/mL for 300 mg dose and from 29.2 ± 18.7 to 36.5 ± 22.2 mcg/mL for 200 mg dose administered every other week.7
- Volume of distribution
The estimated volume of distribution is 4.8 ± 1.3 L.3
- Protein binding
There is limited data on the serum protein binding profile of dupilumab.
- Metabolism
Being a monoclonal antibody, dupilumab is not expected to undergo significant hepatic metabolism.8 While the metabolism of dupilumab has not been characterized, it is speculated that dupilumab undergoes nonspecific degradation into smaller peptides and amino acids, as often observed with endogenous IgG.3
- Route of elimination
Being a monoclonal antibody, dupilumab is not expected to undergo significant renal elimination. It is proposed that dupilumab is eliminated via parallel linear and nonlinear pathways. At higher concentrations, dupilumab is primarily cleared through a non-saturable proteolytic pathway. At lower concentrations, it undergoes a non-linear saturable IL-4R α target-mediated elimination.8
- Half-life
There is limited human data on the half-life of dupilumab.8 In single-dose pharmacokinetic studies, the mean half-life of dupilumab following intravenous or subcutaneous administration ranged from 4.8 to 7 days in rats and 11.7 to 20.5 days in cynomolgus monkeys.11,12 In these studies, the mean half-life was comparable was comparable following intravenous and subcutaneous administration.11
- Clearance
There is limited data on the clearance of dupilumab.8
- Adverse Effects
- Improve decision support & research outcomesWith structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates.Improve decision support & research outcomes with our structured adverse effects data.
- Toxicity
There is limited data on the overdose of dupilumab. As there is no specific treatment for dupilumab, close monitoring of the patient with appropriate symptomatic treatment is advised in case of suspected overdosage.[]
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRs
- Not Available
Interactions
- Drug Interactions
- This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
Drug Interaction Integrate drug-drug
interactions in your softwareAbciximab The risk or severity of adverse effects can be increased when Abciximab is combined with Dupilumab. Adalimumab The risk or severity of adverse effects can be increased when Adalimumab is combined with Dupilumab. Adenovirus type 7 vaccine live The therapeutic efficacy of Adenovirus type 7 vaccine live can be decreased when used in combination with Dupilumab. Aducanumab The risk or severity of adverse effects can be increased when Dupilumab is combined with Aducanumab. Alemtuzumab The risk or severity of adverse effects can be increased when Alemtuzumab is combined with Dupilumab. Alirocumab The risk or severity of adverse effects can be increased when Alirocumab is combined with Dupilumab. Amivantamab The risk or severity of adverse effects can be increased when Dupilumab is combined with Amivantamab. Anifrolumab The risk or severity of adverse effects can be increased when Anifrolumab is combined with Dupilumab. Ansuvimab The risk or severity of adverse effects can be increased when Dupilumab is combined with Ansuvimab. Anthrax immune globulin human The risk or severity of adverse effects can be increased when Anthrax immune globulin human is combined with Dupilumab. Identify potential medication risksEasily compare up to 40 drugs with our drug interaction checker.Get severity rating, description, and management advice.Learn more - Food Interactions
- No interactions found.
Products
- Drug product information from 10+ global regionsOur datasets provide approved product information including:dosage, form, labeller, route of administration, and marketing period.Access drug product information from over 10 global regions.
- Brand Name Prescription Products
Name Dosage Strength Route Labeller Marketing Start Marketing End Region Image Dupixent Injection, solution 150 mg/ml Subcutaneous SANOFI WINTHROP INDUSTRIE 2020-12-16 Not applicable EU Dupixent Injection, solution 175 mg/ml Subcutaneous SANOFI WINTHROP INDUSTRIE 2020-12-16 Not applicable EU Dupixent Solution 200 mg / 1.14 mL Subcutaneous Sanofi Aventis 2022-06-23 Not applicable Canada Dupixent Solution 150 mg / mL Subcutaneous Sanofi Aventis 2018-02-06 Not applicable Canada Dupixent Injection, solution 175 mg/ml Subcutaneous SANOFI WINTHROP INDUSTRIE 2020-12-16 Not applicable EU Dupixent Injection, solution 150 mg/ml Subcutaneous SANOFI WINTHROP INDUSTRIE 2022-06-07 Not applicable EU Dupixent Injection, solution 300 mg/2mL Subcutaneous sanofi-aventis U.S. LLC 2020-06-19 Not applicable US Dupixent Injection, solution 150 mg/ml Subcutaneous SANOFI WINTHROP INDUSTRIE 2020-12-16 Not applicable EU Dupixent Injection, solution 150 mg/ml Subcutaneous SANOFI WINTHROP INDUSTRIE 2020-12-16 Not applicable EU Dupixent Injection, solution 150 mg/ml Subcutaneous SANOFI WINTHROP INDUSTRIE 2020-12-16 Not applicable EU
Categories
- ATC Codes
- D11AH05 — Dupilumab
- Drug Categories
- Agents for Dermatitis, Excluding Corticosteroids
- Amino Acids, Peptides, and Proteins
- Anti-Asthmatic Agents
- Antibodies
- Antibodies, Monoclonal
- Blood Proteins
- Dermatologicals
- Globulins
- Immunoglobulins
- Immunoproteins
- Interleukin 4 Receptor alpha Antagonists
- Interleukin-4 Receptor alpha Antagonist
- Interleukin-4 Receptor alpha Subunit, antagonists & inhibitors
- Misc. Skin and Mucous Membrane Agents
- Proteins
- Serum Globulins
- Chemical TaxonomyProvided by Classyfire
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
- Affected organisms
- Humans and other mammals
Chemical Identifiers
- UNII
- 420K487FSG
- CAS number
- 1190264-60-8
References
- General References
- Wenzel S, Ford L, Pearlman D, Spector S, Sher L, Skobieranda F, Wang L, Kirkesseli S, Rocklin R, Bock B, Hamilton J, Ming JE, Radin A, Stahl N, Yancopoulos GD, Graham N, Pirozzi G: Dupilumab in persistent asthma with elevated eosinophil levels. N Engl J Med. 2013 Jun 27;368(26):2455-66. doi: 10.1056/NEJMoa1304048. Epub 2013 May 21. [Article]
- Frampton JE, Blair HA: Dupilumab: A Review in Moderate-to-Severe Atopic Dermatitis. Am J Clin Dermatol. 2018 Aug;19(4):617-624. doi: 10.1007/s40257-018-0370-9. [Article]
- D'Ippolito D, Pisano M: Dupilumab (Dupixent): An Interleukin-4 Receptor Antagonist for Atopic Dermatitis. P T. 2018 Sep;43(9):532-535. [Article]
- Sastre J, Davila I: Dupilumab: A New Paradigm for the Treatment of Allergic Diseases. J Investig Allergol Clin Immunol. 2018 Jun;28(3):139-150. doi: 10.18176/jiaci.0254. [Article]
- Davis JD, Bansal A, Hassman D, Akinlade B, Li M, Li Z, Swanson B, Hamilton JD, DiCioccio AT: Evaluation of Potential Disease-Mediated Drug-Drug Interaction in Patients With Moderate-to-Severe Atopic Dermatitis Receiving Dupilumab. Clin Pharmacol Ther. 2018 Dec;104(6):1146-1154. doi: 10.1002/cpt.1058. Epub 2018 Apr 2. [Article]
- Hurdayal R, Brombacher F: Interleukin-4 Receptor Alpha: From Innate to Adaptive Immunity in Murine Models of Cutaneous Leishmaniasis. Front Immunol. 2017 Nov 10;8:1354. doi: 10.3389/fimmu.2017.01354. eCollection 2017. [Article]
- FDA Approved Drug Products: Dupixent (dupilumab) for subcutaneous injection [Link]
- EMA Approved Drug Products: Dupixent (dupilumab) subcutaneous injection [Link]
- Dupixent® (dupilumab) Approved for Severe Asthma by European Commission - Regeneron [Link]
- FDA approves first treatment for chronic rhinosinusitis with nasal polyps [Link]
- European Medicines Agency: Dupixent (dupilumab) Public Assessment Report [Link]
- Australian Public Assessment Report for Dupilumab - TGA [Link]
- Health Canada Approved Drug Products: DUPIXENT (dupilumab) subcutaneous injection [Link]
- FDA Approved Drug Products: Dupixent (dupilumab) for subcutaneous injection (May 2022) [Link]
- FDA Approved Drug Products: DUPIXENT (dupilumab) injection, for subcutaneous use (June 2022) [Link]
- FDA Approved Drug Products: DUPIXENT (dupilumab) injection, for subcutaneous use (September 2022) [Link]
- External Links
Clinical Trials
- Clinical Trials
Phase Status Purpose Conditions Count 4 Active Not Recruiting Basic Science Asthma 1 4 Active Not Recruiting Treatment Asthma 2 4 Active Not Recruiting Treatment Chronic Rhinosinusitis Phenotype With Nasal Polyps (CRSwNP) 1 4 Active Not Recruiting Treatment Moderate to Severe Atopic Dermatitis 1 4 Completed Basic Science Atopic Dermatitis 1 4 Completed Treatment Atopic Dermatitis 5 4 Not Yet Recruiting Treatment Atopic Dermatitis 2 4 Not Yet Recruiting Treatment Atopic Dermatitis / Sleep Disturbance 1 4 Recruiting Basic Science Atopic Dermatitis 1 4 Recruiting Treatment Allergic Contact Dermatitis 1
Pharmacoeconomics
- Manufacturers
- Not Available
- Packagers
- Not Available
- Dosage Forms
Form Route Strength Injection Subcutaneous Injection, solution Parenteral; Subcutaneous 200 MG Injection, solution Parenteral; Subcutaneous 300 MG Injection, solution Subcutaneous 100 mg/0.67mL Injection, solution Subcutaneous 150 mg/ml Injection, solution Subcutaneous 175 mg/ml Injection, solution Subcutaneous 200 mg/1.14mL Injection, solution Subcutaneous 300 mg/2mL Solution Subcutaneous 100 mg / 0.67 mL Solution Subcutaneous 150 mg / mL Solution Subcutaneous 200 mg / 1.14 mL Injection, solution 150 mg/ml Solution Subcutaneous 200 mg Injection, solution Subcutaneous Solution Subcutaneous 300 mg - Prices
- Not Available
- Patents
- Not Available
Properties
- State
- Not Available
- Experimental Properties
- Not Available
Targets

- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- Actions
- InhibitorAntibody
- General Function
- Receptor signaling protein activity
- Specific Function
- Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regu...
- Gene Name
- IL4R
- Uniprot ID
- P24394
- Uniprot Name
- Interleukin-4 receptor subunit alpha
- Molecular Weight
- 89657.42 Da
References
- Wenzel S, Ford L, Pearlman D, Spector S, Sher L, Skobieranda F, Wang L, Kirkesseli S, Rocklin R, Bock B, Hamilton J, Ming JE, Radin A, Stahl N, Yancopoulos GD, Graham N, Pirozzi G: Dupilumab in persistent asthma with elevated eosinophil levels. N Engl J Med. 2013 Jun 27;368(26):2455-66. doi: 10.1056/NEJMoa1304048. Epub 2013 May 21. [Article]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- Actions
- InhibitorAntibody
- General Function
- Interleukin-13 receptor binding
- Specific Function
- Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses.
- Gene Name
- IL13
- Uniprot ID
- P35225
- Uniprot Name
- Interleukin-13
- Molecular Weight
- 15815.585 Da
References
- Agarwal A, Spath D, Sherris DA, Kita H, Ponikau JU: Therapeutic Antibodies for Nasal Polyposis Treatment: Where Are We Headed? Clin Rev Allergy Immunol. 2020 Oct;59(2):141-149. doi: 10.1007/s12016-019-08734-z. [Article]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- Actions
- InhibitorAntibody
- General Function
- Interleukin-4 receptor binding
- Specific Function
- Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-...
- Gene Name
- IL4
- Uniprot ID
- P05112
- Uniprot Name
- Interleukin-4
- Molecular Weight
- 17492.09 Da
References
- Agarwal A, Spath D, Sherris DA, Kita H, Ponikau JU: Therapeutic Antibodies for Nasal Polyposis Treatment: Where Are We Headed? Clin Rev Allergy Immunol. 2020 Oct;59(2):141-149. doi: 10.1007/s12016-019-08734-z. [Article]
Drug created at October 20, 2016 21:30 / Updated at March 11, 2023 21:11