Pancrelipase lipase

Identification

Summary

Pancrelipase lipase is a lipase used to treat pancreatic exocrine insufficiency.

Brand Names
Cotazym, Creon, Pancrease MT, Pancreaze, Pertzye, Viokace, Zenpep
Generic Name
Pancrelipase lipase
DrugBank Accession Number
DB13147
Background

Pancrelipase, in general, is composed of a mixture of pancreatic enzymes which include amylases, lipases, and proteases. These enzymes are extracted from porcine pancreatic glands.3 The pancrelipase lipase is an enzyme secreted by the pancreas that is responsible for the hydrolysis of dietary fat molecules in the human digestive system.1 The pancrelipase mixture, including pancrelipase lipase, was developed by Ortho-McNeil-Janssen Pharmaceuticals, Inc and FDA approved on April 12, 2010.4

Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Other protein based therapies
Protein Structure
Db13147
Protein Chemical Formula
Not Available
Protein Average Weight
48000.0 Da
Sequences
>sp|P00591|LIPP_PIG Pancreatic triacylglycerol lipase OS=Sus scrofa OX=9823 GN=PNLIP PE=1 SV=2
SEVCFPRLGCFSDDAPWAGIVQRPLKILPWSPKDVDTRFLLYTNQNQNNYQELVADPSTI
TNSNFRMDRKTRFIIHGFIDKGEEDWLSNICKNLFKVESVNCICVDWKGGSRTGYTQASQ
NIRIVGAEVAYFVEVLKSSLGYSPSNVHVIGHSLGSHAAGEAGRRTNGTIERITGLDPAE
PCFQGTPELVRLDPSDAKFVDVIHTDAAPIIPNLGFGMSQTVGHLDFFPNGGKQMPGCQK
NILSQIVDIDGIWEGTRDFVACNHLRSYKYYADSILNPDGFAGFPCDSYNVFTANKCFPC
PSEGCPQMGHYADRFPGKTNGVSQVFYLNTGDASNFARWRYKVSVTLSGKKVTGHILVSL
FGNEGNSRQYEIYKGTLQPDNTHSDEFDSDVEVGDLQKVKFIWYNNNVINPTLPRVGASK
ITVERNDGKVYDFCSQETVREEVLLTLNPC
>sp|P02703|COL_PIG Colipase OS=Sus scrofa OX=9823 GN=CLPS PE=1 SV=3
MEKVLALLLVTLTVAYAVPDPRGIIINLDEGELCLNSAQCKSNCCQHDTILSLSRCALKA
RENSECSAFTLYGVYYKCPCERGLTCEGDKSLVGSITNTNFGICHDVGRSSD
Download FASTA Format
Synonyms
  • Lipase, pancreatic
  • Pancreatic lipase

Pharmacology

Indication

Please refer to Pancrelipase.

Pharmacology
Accelerate your drug discovery research with the industry’s only fully connected ADMET dataset, ideal for:
Machine Learning
Data Science
Drug Discovery
Accelerate your drug discovery research with our fully connected ADMET dataset
Learn more
Associated Conditions
Associated Therapies
Contraindications & Blackbox Warnings
Contraindications
Contraindications & Blackbox Warnings
With our commercial data, access important information on dangerous risks, contraindications, and adverse effects.
Learn more
Our Blackbox Warnings cover Risks, Contraindications, and Adverse Effects
Learn more
Pharmacodynamics

Please refer to Pancrelipase.

Mechanism of action

Pancrelipase lipase catalyzes the hydrolysis of triglycerides to monoglycerides, glycerol, and fatty acids. This activity is performed by the hydrolyzation of the esters of fatty acids. The hydrolysis is started by the action of colipase which helps to anchor lipase to the lipid-water membrane of the micelle producing a surface change on lipase. The hydrophobic active site is exposed for the binding of triglycerides and further interaction with the catalytic triad. In this triad, the function of the three amino acids allows the formation of a deprotonated serine which becomes a nucleophile and act on the ester carbonyl of the fatty acids for the later formation of monoglyceride and fatty acid monomers.2

TargetActionsOrganism
ADietary fat
cleavage
Humans
Absorption

Please refer to Pancrelipase.

Volume of distribution

Please refer to Pancrelipase.

Protein binding

Please refer to Pancrelipase.

Metabolism

Please refer to Pancrelipase.

Route of elimination

Please refer to Pancrelipase.

Half-life

Please refer to Pancrelipase.

Clearance

Please refer to Pancrelipase.

Adverse Effects
Medicalerrors
Reduce medical errors
and improve treatment outcomes with our comprehensive & structured data on drug adverse effects.
Learn more
Reduce medical errors & improve treatment outcomes with our adverse effects data
Learn more
Toxicity

Please refer to Pancrelipase.

Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
Not Available
Food Interactions
  • Take with food.

Products

Products
Comprehensive & structured drug product info
From application numbers to product codes, connect different identifiers through our commercial datasets.
Learn more
Easily connect various identifiers back to our datasets
Learn more
Product Images
Over the Counter Products
NameDosageStrengthRouteLabellerMarketing StartMarketing EndRegionImage
Formula C & ETablet150 unitOralAbundance Naturally Ltd1998-01-052006-06-16Canada flag
Mixture Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing EndRegionImage
CotazymPancrelipase lipase (10000 units) + Pancrelipase amylase (40000 units) + Pancrelipase protease (35000 units)CapsuleOralOrganon Canada Inc.1973-12-31Not applicableCanada flag
Cotazym Ecs 20Pancrelipase lipase (25000 units) + Pancrelipase amylase (100000 units) + Pancrelipase protease (100000 units)Capsule, delayed releaseOralOrganon Canada Inc.1989-12-31Not applicableCanada flag
Cotazym Ecs 4Pancrelipase lipase (4000 unit) + Pancrelipase amylase (11000 unit) + Pancrelipase protease (11000 unit)CapsuleOralMerck Ltd.1997-08-182012-01-23Canada flag
Cotazym Ecs 8Pancrelipase lipase (10800 units) + Pancrelipase amylase (42000 units) + Pancrelipase protease (45000 units)Capsule, delayed releaseOralOrganon Canada Inc.1980-12-31Not applicableCanada flag
CreonPancrelipase lipase (24000 [USP'U]/1) + Pancrelipase amylase (120000 [USP'U]/1) + Pancrelipase protease (76000 [USP'U]/1)Capsule, delayed release pelletsOralAbbVie Inc.2009-04-30Not applicableUS flag0032 122420171018 3478 3zx10l
CreonPancrelipase lipase (12000 [USP'U]/1) + Pancrelipase amylase (60000 [USP'U]/1) + Pancrelipase protease (38000 [USP'U]/1)Capsule, delayed release pelletsOralAtlantic Biologicals Corps.2010-08-13Not applicableUS flag17856 121220171018 3478 1444e92
CreonPancrelipase lipase (36000 [USP'U]/1) + Pancrelipase amylase (180000 [USP'U]/1) + Pancrelipase protease (114000 [USP'U]/1)Capsule, delayed release pelletsOralAbbVie Inc.2013-03-14Not applicableUS flag0032 301620171018 3478 1xzy1f3
CreonPancrelipase lipase (12000 [USP'U]/1) + Pancrelipase amylase (60000 [USP'U]/1) + Pancrelipase protease (38000 [USP'U]/1)Capsule, delayed release pelletsOralAbbVie Inc.2009-04-30Not applicableUS flag0032 121220171018 3478 1gpsri6
CreonPancrelipase lipase (24000 [USP'U]/1) + Pancrelipase amylase (120000 [USP'U]/1) + Pancrelipase protease (76000 [USP'U]/1)Capsule, delayed release pelletsOralAtlantic Biologicals Corps.2010-08-13Not applicableUS flag17856 122420171018 3478 17bvxdq
CreonPancrelipase lipase (6000 [USP'U]/1) + Pancrelipase amylase (30000 [USP'U]/1) + Pancrelipase protease (19000 [USP'U]/1)Capsule, delayed release pelletsOralAtlantic Biologicals Corps.2010-08-13Not applicableUS flag17856 120620171018 3478 1x59skm
Unapproved/Other Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing EndRegionImage
Creon 10 MinimicrospheresPancrelipase lipase (10000 [USP'U]/1) + Pancrelipase amylase (33200 [USP'U]/1) + Pancrelipase protease (37500 [USP'U]/1)Capsule, delayed releaseOralPhysicians Total Care, Inc.2006-09-122009-09-30US flag
Creon 20 MinimicrospheresPancrelipase lipase (20000 [USP'U]/1) + Pancrelipase amylase (66400 [USP'U]/1) + Pancrelipase protease (75000 [USP'U]/1)Capsule, delayed releaseOralPhysicians Total Care, Inc.1995-01-172009-09-30US flag
PancrelipasePancrelipase lipase (20000 [USP'U]/1) + Pancrelipase amylase (56000 [USP'U]/1) + Pancrelipase protease (44000 [USP'U]/1)Capsule, delayed releaseOralKaiser Foundations Hospitals2010-02-012010-12-31US flag

Categories

Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available
Affected organisms
  • Humans and other mammals

Chemical Identifiers

UNII
8MYC33932O
CAS number
9001-62-1

References

General References
  1. Chapus C, Rovery M, Sarda L, Verger R: Minireview on pancreatic lipase and colipase. Biochimie. 1988 Sep;70(9):1223-34. [Article]
  2. Chapus C, Semeriva M, Bovier-Lapierre C, Desnuelle P: Mechanism of pancreatic lipase action. 1. Interfacial activation of pancreatic lipase. Biochemistry. 1976 Nov 16;15(23):4980-7. [Article]
  3. Creon monograph [Link]
  4. FDA approval [Link]
PubChem Substance
347911431
RxNav
1427018
Wikipedia
Pancreatic_lipase_family
FDA label
Download (483 KB)
MSDS
Download (62.3 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
4Active Not RecruitingTreatmentExocrine Pancreatic Insufficiency1
4CompletedTreatmentCystic Fibrosis (CF) / Exocrine Pancreatic Insufficiency2
4CompletedTreatmentExocrine Pancreatic Insufficiency / Pancreatitis, Chronic1
4CompletedTreatmentPancreatic Insufficiency1
4CompletedTreatmentPancreatitis, Chronic1
4Not Yet RecruitingTreatmentExocrine Pancreatic Insufficiency1
4RecruitingTreatmentCystic Fibrosis (CF)1
4TerminatedTreatmentPatients With Coeliac Disease and Chronic Diarrhoea (>3 Loose/ Liquid Motions a Day for More Than 4 Weeks) / Patients With Pancreatic Exocrine Insufficiency1
4WithdrawnTreatmentExocrine Pancreatic Insufficiency in Subjects With Diabetes Mellitus Type 21
3CompletedTreatmentCystic Fibrosis (CF) / Exocrine Pancreatic Insufficiency1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage Forms
FormRouteStrength
Capsule, delayed release pelletsOral
Capsule, delayed releaseOral
CapsuleOral
Capsule, coated pelletsOral
Tablet, coatedOral
TabletOral150 unit
Granule, delayed releaseOral
Capsule, extended releaseOral
Capsule, coatedOral22500 U Ph.Eu
TabletOral
PowderOral
Prices
Not Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)Region
US9198871No2015-12-012030-02-07US flag
US8562979No2013-10-222028-02-20US flag
US8562980No2013-10-222028-02-20US flag
US8562981No2013-10-222028-02-20US flag
US8221747No2012-07-172028-02-20US flag
US8562978No2013-10-222028-02-20US flag
US8246950No2012-08-212028-02-20US flag
US7658918No2010-02-092028-02-20US flag

Properties

State
Solid
Experimental Properties
PropertyValueSource
water solubilitySlightly soluble 'MSDS'
isoelectric point7.4Iizuka K. et al. 1991. Ann clin Biochem.

Targets

Drugtargets
Accelerate your drug discovery research
with our fully connected ADMET & drug target dataset.
Learn more
Accelerate your drug discovery research with our ADMET & drug target dataset
Learn more
1. Dietary fat
Kind
Group
Organism
Humans
Pharmacological action
Yes
Actions
Cleavage
References
  1. Chapus C, Semeriva M, Bovier-Lapierre C, Desnuelle P: Mechanism of pancreatic lipase action. 1. Interfacial activation of pancreatic lipase. Biochemistry. 1976 Nov 16;15(23):4980-7. [Article]

Drug created on November 16, 2016 15:28 / Updated on July 24, 2021 14:58