Pancrelipase lipase

Explore a selection of our essential drug information below, or:

Unlock enhanced features & extensive drug insights, including detailed interaction data & regulatory status. Create a free account.

SUBSCRIBERECOMMENDED FOR PHARMA

Explore the full scope of our drug knowledge tailored for pharmaceutical research needs in our data library. Learn more.

Identification

Summary

Pancrelipase lipase is a lipase used to treat pancreatic exocrine insufficiency.

Brand Names

Cotazym, Creon, Pancrease MT, Pancreaze, Pertzye, Viokace, Zenpep

Generic Name

Pancrelipase lipase

DrugBank Accession Number

DB13147

Background

Pancrelipase, in general, is composed of a mixture of pancreatic enzymes which include amylases, lipases, and proteases. These enzymes are extracted from porcine pancreatic glands.³ The pancrelipase lipase is an enzyme secreted by the pancreas that is responsible for the hydrolysis of dietary fat molecules in the human digestive system.¹ The pancrelipase mixture, including pancrelipase lipase, was developed by Ortho-McNeil-Janssen Pharmaceuticals, Inc and FDA approved on April 12, 2010.⁴

Type

Biotech

Groups

Approved

Biologic Classification

Protein Based Therapies
Other protein based therapies

Protein Structure

Protein Chemical Formula: Not Available
Protein Average Weight: 48000.0 Da

Sequences

>sp|P00591|LIPP_PIG Pancreatic triacylglycerol lipase OS=Sus scrofa OX=9823 GN=PNLIP PE=1 SV=2
SEVCFPRLGCFSDDAPWAGIVQRPLKILPWSPKDVDTRFLLYTNQNQNNYQELVADPSTI
TNSNFRMDRKTRFIIHGFIDKGEEDWLSNICKNLFKVESVNCICVDWKGGSRTGYTQASQ
NIRIVGAEVAYFVEVLKSSLGYSPSNVHVIGHSLGSHAAGEAGRRTNGTIERITGLDPAE
PCFQGTPELVRLDPSDAKFVDVIHTDAAPIIPNLGFGMSQTVGHLDFFPNGGKQMPGCQK
NILSQIVDIDGIWEGTRDFVACNHLRSYKYYADSILNPDGFAGFPCDSYNVFTANKCFPC
PSEGCPQMGHYADRFPGKTNGVSQVFYLNTGDASNFARWRYKVSVTLSGKKVTGHILVSL
FGNEGNSRQYEIYKGTLQPDNTHSDEFDSDVEVGDLQKVKFIWYNNNVINPTLPRVGASK
ITVERNDGKVYDFCSQETVREEVLLTLNPC

>sp|P02703|COL_PIG Colipase OS=Sus scrofa OX=9823 GN=CLPS PE=1 SV=3
MEKVLALLLVTLTVAYAVPDPRGIIINLDEGELCLNSAQCKSNCCQHDTILSLSRCALKA
RENSECSAFTLYGVYYKCPCERGLTCEGDKSLVGSITNTNFGICHDVGRSSD

Download FASTA Format

Synonyms

Lipase, pancreatic
Pancreatic lipase

Unlock the secrets to drugging the undruggable

Discover how groundbreaking research is turning "undruggable" targets into therapeutic opportunities.

Download eBook

Unlock the secrets to drugging the undruggable

Download eBook

Pharmacology

Indication

Please refer to Pancrelipase.

Reduce drug development failure rates

Build, train, & validate machine-learning models
with evidence-based and structured datasets.

See how

Build, train, & validate predictive machine-learning models with structured datasets.

See how

Associated Conditions

Indication Type	Indication	Combined Product Details	Approval Level	Dose Form
Used in combination to treat	Exocrine pancreatic insufficiency	Combination Product in combination with: Pancrelipase amylase (DB11065), Pancrelipase protease (DB11066)	••••••••••••	•••••••• ••••••• •••••••
Used in combination to treat	Exocrine pancreatic insufficiency	Combination Product in combination with: Pancrelipase amylase (DB11065), Pancrelipase protease (DB11066)	••••••••••••	•••••••• ••••••• •••••••
Used in combination to treat	Exocrine pancreatic insufficiency	Combination Product in combination with: Pancrelipase protease (DB11066), Pancrelipase amylase (DB11065)	••••••••••••	•••••••• ••••••• •••••••
Used in combination to treat	Exocrine pancreatic insufficiency	Combination Product in combination with: Pancrelipase protease (DB11066), Pancrelipase amylase (DB11065)	••••••••••••	•••••••• ••••••• •••••••
Used in combination to treat	Exocrine pancreatic insufficiency	Combination Product in combination with: Pancrelipase amylase (DB11065), Pancrelipase protease (DB11066)	••••••••••••	•••••••• ••••••• •••••••

Associated Therapies

Pancreatic enzyme replacement

Contraindications & Blackbox Warnings

Prevent Adverse Drug Events Today

Tap into our Clinical API for life-saving information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.

Learn more

Avoid life-threatening adverse drug events with our Clinical API

Learn more

Pharmacodynamics

Please refer to Pancrelipase.

Mechanism of action

Pancrelipase lipase catalyzes the hydrolysis of triglycerides to monoglycerides, glycerol, and fatty acids. This activity is performed by the hydrolyzation of the esters of fatty acids. The hydrolysis is started by the action of colipase which helps to anchor lipase to the lipid-water membrane of the micelle producing a surface change on lipase. The hydrophobic active site is exposed for the binding of triglycerides and further interaction with the catalytic triad. In this triad, the function of the three amino acids allows the formation of a deprotonated serine which becomes a nucleophile and act on the ester carbonyl of the fatty acids for the later formation of monoglyceride and fatty acid monomers.²

Target	Actions	Organism
ADietary fat	cleavage	Humans

Absorption

Please refer to Pancrelipase.

Volume of distribution

Please refer to Pancrelipase.

Protein binding

Please refer to Pancrelipase.

Metabolism

Please refer to Pancrelipase.

Route of elimination

Please refer to Pancrelipase.

Half-life

Please refer to Pancrelipase.

Clearance

Please refer to Pancrelipase.

Adverse Effects

Improve decision support & research outcomes

With structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates. View sample adverse effects data in our new Data Library!

See the data

Improve decision support & research outcomes with our structured adverse effects data.

See a data sample

Toxicity

Please refer to Pancrelipase.

Pathways

Not Available

Pharmacogenomic Effects/ADRs

Not Available

Interactions

Drug Interactions

This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.

Not Available

Food Interactions

Take with food.

Products

Drug product information from 10+ global regions

Our datasets provide approved product information including:
dosage, form, labeller, route of administration, and marketing period.

Access now

Access drug product information from over 10 global regions.

Access now

Product Images

Over the Counter Products

Name	Dosage	Strength	Route	Labeller	Marketing Start	Marketing End	Region	Image
Formula C & E	Tablet	150 unit	Oral	Abundance Naturally Ltd	1998-01-05	2006-06-16

Mixture Products

Name	Ingredients	Dosage	Route	Labeller	Marketing Start	Marketing End
Cotazym	Pancrelipase lipase (10000 units) + Pancrelipase amylase (40000 units) + Pancrelipase protease (35000 units)	Capsule	Oral	Organon Canada Inc.	1973-12-31	Not applicable
Cotazym Ecs 20	Pancrelipase lipase (25000 units) + Pancrelipase amylase (100000 units) + Pancrelipase protease (100000 units)	Capsule, delayed release	Oral	Organon Canada Inc.	1989-12-31	Not applicable
Cotazym Ecs 4	Pancrelipase lipase (4000 unit) + Pancrelipase amylase (11000 unit) + Pancrelipase protease (11000 unit)	Capsule	Oral	Merck Ltd.	1997-08-18	2012-01-23
Cotazym Ecs 8	Pancrelipase lipase (10800 units) + Pancrelipase amylase (42000 units) + Pancrelipase protease (45000 units)	Capsule, delayed release	Oral	Organon Canada Inc.	1980-12-31	Not applicable
Creon	Pancrelipase lipase (36000 [USP'U]/1) + Pancrelipase amylase (180000 [USP'U]/1) + Pancrelipase protease (114000 [USP'U]/1)	Capsule, delayed release pellets	Oral	AbbVie Inc.	2023-10-12	Not applicable

Unapproved/Other Products

Name	Ingredients	Dosage	Route	Labeller	Marketing Start	Marketing End
Creon 10 Minimicrospheres	Pancrelipase lipase (10000 [USP'U]/1) + Pancrelipase amylase (33200 [USP'U]/1) + Pancrelipase protease (37500 [USP'U]/1)	Capsule, delayed release	Oral	Physicians Total Care, Inc.	2006-09-12	2009-09-30
Creon 20 Minimicrospheres	Pancrelipase lipase (20000 [USP'U]/1) + Pancrelipase amylase (66400 [USP'U]/1) + Pancrelipase protease (75000 [USP'U]/1)	Capsule, delayed release	Oral	Physicians Total Care, Inc.	1995-01-17	2009-09-30
Pancrelipase	Pancrelipase lipase (20000 [USP'U]/1) + Pancrelipase amylase (56000 [USP'U]/1) + Pancrelipase protease (44000 [USP'U]/1)	Capsule, delayed release	Oral	Kaiser Foundations Hospitals	2010-02-01	2010-12-31

Chemical Identifiers

UNII: 8MYC33932O
CAS number: 9001-62-1

References

General References

Chapus C, Rovery M, Sarda L, Verger R: Minireview on pancreatic lipase and colipase. Biochimie. 1988 Sep;70(9):1223-34. [Article]
Chapus C, Semeriva M, Bovier-Lapierre C, Desnuelle P: Mechanism of pancreatic lipase action. 1. Interfacial activation of pancreatic lipase. Biochemistry. 1976 Nov 16;15(23):4980-7. [Article]
Creon monograph [Link]
FDA approval [Link]

External Links

PubChem Substance: 347911431
RxNav: 6406
Wikipedia: Pancreatic_lipase_family

FDA label

Download (483 KB)

MSDS

Download (62.3 KB)

Clinical Trials

Clinical Trials Clinical Trial & Rare Diseases Add-on Data Package Explore 4,000+ rare diseases, orphan drugs & condition pairs, clinical trial why stopped data, & more. Preview package

Phase	Status	Purpose	Conditions	Count	Start Date	Why Stopped	100+ additional columns
Unlock 175K+ rows when you subscribe.View sample data
Not Available	Completed	Not Available	Obesity	1	somestatus	stop reason	just information to hide
Not Available	Completed	Not Available	Pancreatic Fistula	1	somestatus	stop reason	just information to hide
Not Available	Completed	Not Available	Pancreatitis, Chronic	1	somestatus	stop reason	just information to hide
Not Available	Completed	Basic Science	Pancreatitis	1	somestatus	stop reason	just information to hide
Not Available	Completed	Treatment	Cystic Fibrosis (CF)	1	somestatus	stop reason	just information to hide

Pharmacoeconomics

Manufacturers

Not Available

Packagers

Not Available

Dosage Forms

Form	Route	Strength
Capsule, delayed release pellets	Oral
Capsule, delayed release	Oral
Capsule, delayed release pellets	Not applicable
Capsule, delayed release pellets
Granule, delayed release	Oral
Capsule	Oral
Tablet, coated	Oral
Capsule, coated pellets	Oral
Tablet	Oral	150 unit
Capsule, extended release	Oral
Capsule, coated	Oral	22500 U Ph.Eu
Tablet	Oral
Powder	Oral

Prices

Not Available

Patents

Patent Number	Pediatric Extension	Approved	Expires (estimated)
US9198871	No	2015-12-01	2030-02-07
US8562979	No	2013-10-22	2028-02-20
US8562980	No	2013-10-22	2028-02-20
US8562981	No	2013-10-22	2028-02-20
US8221747	No	2012-07-17	2028-02-20
US8562978	No	2013-10-22	2028-02-20
US8246950	No	2012-08-21	2028-02-20
US7658918	No	2010-02-09	2028-02-20

Properties

State

Solid

Experimental Properties

Property	Value	Source
water solubility	Slightly soluble	'MSDS'
isoelectric point	7.4	Iizuka K. et al. 1991. Ann clin Biochem.

Targets

Build, predict & validate machine-learning models

Use our structured and evidence-based datasets to unlock new
insights and accelerate drug research.

Learn more

Use our structured and evidence-based datasets to unlock new insights and accelerate drug research.

Learn more

1. Dietary fat

Kind

Group

Organism

Humans

Pharmacological action

Yes

Actions

Cleavage

References

Chapus C, Semeriva M, Bovier-Lapierre C, Desnuelle P: Mechanism of pancreatic lipase action. 1. Interfacial activation of pancreatic lipase. Biochemistry. 1976 Nov 16;15(23):4980-7. [Article]

Drug created at November 16, 2016 15:28 / Updated at October 03, 2024 04:54

Pancrelipase lipase

Identification

Pharmacology

Interactions

Products

Categories

Chemical Identifiers

References

Clinical Trials

Clinical Trial & Rare Diseases Add-on Data Package

Pharmacoeconomics

Properties

Targets

References