DNA gyrase subunit A
Details
- Name
- DNA gyrase subunit A
- Kind
- protein
- Synonyms
- 5.99.1.3
- Gene Name
- gyrA
- UniProtKB Entry
- P20831Swiss-Prot
- Organism
- Staphylococcus aureus
- NCBI Taxonomy ID
- 1280
- Amino acid sequence
>lcl|BSEQ0018827|DNA gyrase subunit A MAELPQSRINERNITSEMRESFLDYAMSVIVARALPDVRDGLKPVHRRILYGLNEQGMTP DKSYKKSARIVGDVMGKYHPHGDSSIYEAMVRMAQDFSYRYPLVDGQGNFGSMDGDGAAA MRYTEARMTKITLELLRDINKDTIDFIDNYDGNEREPSVLPARFPNLLANGASGIAVGMA TNIPPHNLTELINGVLSLSKNPDISIAELMEDIEGPDFPTAGLILGKSGIRRAYETGRGS IQMRSRAVIEERGGGRQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRT GVRVVIDVRKDANASVILNNLYKQTPLQTSFGVNMIALVNGRPKLINLKEALVHYLEHQK TVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIRESDTDKVAMESLQQRFKLSEK QAQAILDMRLRRLTGLERDKIEAEYNELLNYISELEAILADEEVLLQLVRDELTEIRDRF GDDRRTEIQLGGFEDLEDEDLIPEEQIVITLSHNNYIKRLPVSTYRAQNRGGRGVQGMNT LEEDFVSQLVTLSTHDHVLFFTNKGRVYKLKGYEVPELSRQSKGIPVVNAIELENDEVIS TMIAVKDLESEDNFLVFATKRGVVKRSALSNFSRINRNGKIAISFREDDELIAVRLTSGQ EDILIGTSHASLIRFPESTLRPLGRTATGVKGITLREGDEVVGLDVAHANSVDEVLVVTE NGYGKRTPVNDYRLSNRGGKGIKTATITERNGNVVCITTVTGEEDLMIVTNAGVIIRLDV ADISQNGRAAQGVRLIRLGDDQFVSTVAKVKEDAEDETNEDEQSTSTVSEDGTEQQREAV VNDETPGNAIHTEVIDSEENDEDGRIEVRQDFMDRVEEDIQQSLDEDEE
- Number of residues
- 889
- Molecular Weight
- 99620.34
- Theoretical pI
- Not Available
- GO Classification
- FunctionsATP binding / DNA binding / DNA topoisomerase type II (ATP-hydrolyzing) activityProcessesDNA topological change / DNA-dependent DNA replication / response to antibioticComponentschromosome / cytoplasm
- General Function
- A type II topoisomerase that negatively supercoils closed circular double-stranded (ds) DNA in an ATP-dependent manner to modulate DNA topology and maintain chromosomes in an underwound state. Negative supercoiling favors strand separation, and DNA replication, transcription, recombination and repair, all of which involve strand separation. Also able to catalyze the interconversion of other topological isomers of dsDNA rings, including catenanes and knotted rings. Type II topoisomerases break and join 2 DNA strands simultaneously in an ATP-dependent manner.
- Specific Function
- ATP binding
- Pfam Domain Function
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasm
- Gene sequence
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P20831 UniProtKB Entry Name GYRA_STAAU PDB ID(s) 4PLB, 5BS3 - General References
- Margerrison EE, Hopewell R, Fisher LM: Nucleotide sequence of the Staphylococcus aureus gyrB-gyrA locus encoding the DNA gyrase A and B proteins. J Bacteriol. 1992 Mar;174(5):1596-603. [Article]
- Brockbank SM, Barth PT: Cloning, sequencing, and expression of the DNA gyrase genes from Staphylococcus aureus. J Bacteriol. 1993 Jun;175(11):3269-77. [Article]
- Ito H, Yoshida H, Bogaki-Shonai M, Niga T, Hattori H, Nakamura S: Quinolone resistance mutations in the DNA gyrase gyrA and gyrB genes of Staphylococcus aureus. Antimicrob Agents Chemother. 1994 Sep;38(9):2014-23. [Article]
- Hopewell R, Oram M, Briesewitz R, Fisher LM: DNA cloning and organization of the Staphylococcus aureus gyrA and gyrB genes: close homology among gyrase proteins and implications for 4-quinolone action and resistance. J Bacteriol. 1990 Jun;172(6):3481-4. [Article]
- Sreedharan S, Oram M, Jensen B, Peterson LR, Fisher LM: DNA gyrase gyrA mutations in ciprofloxacin-resistant strains of Staphylococcus aureus: close similarity with quinolone resistance mutations in Escherichia coli. J Bacteriol. 1990 Dec;172(12):7260-2. [Article]
- Goswitz JJ, Willard KE, Fasching CE, Peterson LR: Detection of gyrA gene mutations associated with ciprofloxacin resistance in methicillin-resistant Staphylococcus aureus: analysis by polymerase chain reaction and automated direct DNA sequencing. Antimicrob Agents Chemother. 1992 May;36(5):1166-9. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Ciprofloxacin approved, investigational yes target modulator Details Norfloxacin approved unknown target inhibitor Details TNP-2092 investigational yes target inhibitor Details Clinafloxacin investigational yes target modulator Details Danofloxacin experimental, vet_approved yes target modulator Details Temafloxacin withdrawn yes target modulator Details Zoliflodacin investigational yes target modulator Details Finafloxacin approved, investigational yes target inhibitor Details Pazufloxacin investigational yes target inhibitor Details Nemonoxacin investigational yes target inhibitor Details Besifloxacin approved yes target modulator Details Levofloxacin approved, investigational yes target modulator Details Gatifloxacin approved, investigational, withdrawn yes target modulator Details Ofloxacin approved yes target modulator Details Trovafloxacin approved, investigational, withdrawn yes target modulator Details Grepafloxacin approved, investigational, withdrawn yes target modulator Details Sparfloxacin approved, investigational, withdrawn yes target modulator Details Gemifloxacin approved, investigational yes target modulator Details Ozenoxacin approved, investigational yes target modulator Details Moxifloxacin approved, investigational yes target modulator Details Prulifloxacin investigational yes target inhibitor Details