Menotropins

Identification

Summary

Menotropins is a purified combination of human luteinizing hormone and follicle stimulating hormone used to treat female infertility.

Brand Names
Menopur
Generic Name
Menotropins
DrugBank Accession Number
DB00032
Background

Menotropins contains follicle stimulating hormone (FSH) and luteinizing hormone (LH) purified from the urine of postmenopausal women. It is used as a fertility medication that is injected either subcutaneously or intramuscularly. It is composed of LH with 2 subunits, alpha = 92 residues, beta = 121 residues and FSH with 2 subunits, alpha = 92 residues, beta=111 residues.

Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Hormones
Protein Structure
Db00032
Protein Chemical Formula
C1014H1609N287O294S27
Protein Average Weight
23390.3 Da
Sequences
>AlphaChain (LH)
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC
VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
>BetaChain (LH)
SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYR
DVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLF
L
>AlphaChain (FSH)
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC
VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
>BetaChain (FSH)
NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYET
VRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Download FASTA Format
Synonyms
  • Human menopausal gonadotrophin
  • Menotrophin
  • Menotropin
  • Menotropina
  • Menotropins (FSH;LH)

Pharmacology

Indication

For the treatment of female infertility

Pharmacology
Reduce drug development failure rates
Build, train, & validate machine-learning models
with evidence-based and structured datasets.
See how
Build, train, & validate predictive machine-learning models with structured datasets.
See how
Associated Therapies
Contraindications & Blackbox Warnings
Contraindications
Avoid life-threatening adverse drug events
Improve clinical decision support with information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.
Learn more
Avoid life-threatening adverse drug events & improve clinical decision support.
Learn more
Pharmacodynamics

Used to treat female infertility, Menotropins stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Menotropins bind to the LH/hCG/FSH receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.

Mechanism of action

Being a combination drug, Menotropins bind to the follicle stimulating hormone receptor (FSH), which results in ovulation in the absence of sufficient endogenous luteinizing hormone (LH). It also binds the LH receptor, thereby stimulating proper hormone release. The drug contains both FSH and LH, therefore, it induces ovarian follicular growth and development as well as gonadal steroid production in women who do not have ovarian failure. FSH is the primary driver of follicular recruitment and growth in early folliculogenesis, while LH is important for ovarian steroidogenesis and is involved in the physiological events leading to development of a competent pre-ovulatory follicle.

TargetActionsOrganism
AFollicle-stimulating hormone receptor
binder
Humans
ALutropin-choriogonadotropic hormone receptorNot AvailableHumans
Absorption

Not Available

Volume of distribution

Not Available

Protein binding

Not Available

Metabolism
Not Available
Route of elimination

Not Available

Half-life

Not Available

Clearance

Not Available

Adverse Effects
Adverseeffects
Improve decision support & research outcomes
With structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates.
Learn more
Improve decision support & research outcomes with our structured adverse effects data.
Learn more
Toxicity

Not Available

Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
No interactions found.
Food Interactions
No interactions found.

Products

Products2
Drug product information from 10+ global regions
Our datasets provide approved product information including:
dosage, form, labeller, route of administration, and marketing period.
Access now
Access drug product information from over 10 global regions.
Access now
Brand Name Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing EndRegionImage
MenopurPowder, for solution75 unit / vialSubcutaneousFerring Pharmaceuticals2006-09-19Not applicableCanada flag
RepronexPowder, for solution75 unit / vialIntramuscular; SubcutaneousFerring Pharmaceuticals2003-08-282019-04-23Canada flag

Categories

ATC Codes
G03GA02 — Human menopausal gonadotrophinG03GA03 — Serum gonadotrophin
Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available
Affected organisms
  • Humans and other mammals

Chemical Identifiers

UNII
8FYM5179QJ
CAS number
9002-68-0

References

General References
Not Available
UniProt
P01229
Genbank
X00264
PubChem Substance
46504503
ChEMBL
CHEMBL2108427
Therapeutic Targets Database
DAP001027
PharmGKB
PA164749406
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Menotropin
FDA label
Download (175 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
4CompletedTreatmentAnovulatory cycle / Infertility1
4CompletedTreatmentEgg Donation1
4CompletedTreatmentFemale Infertility2
4CompletedTreatmentFertility / Optimal Stimulation Protocol / Reproductive Endocrinology1
4CompletedTreatmentInfertility8
4CompletedTreatmentInfertility / Polycystic Ovarian Syndrome (PCOS)1
4CompletedTreatmentOvarian Stimulation Preceding Intrauterine Insemination1
4CompletedTreatmentPolycystic Ovarian Syndrome (PCOS)1
4RecruitingDiagnosticOvarian Reserve1
4RecruitingHealth Services ResearchFemale Infertility1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
  • Ferring Pharmaceuticals Inc.
Dosage Forms
FormRouteStrength
InjectionIntramuscular; Subcutaneous
Injection, powder, lyophilized, for solutionIntramuscular
Injection, powder, for solutionIntramuscular75 IU/ampoule
Injection, powder, for solutionIntramuscular; Subcutaneous75 IU
Powder, for solutionSubcutaneous75 unit / vial
Injection, powder, for solutionParenteral
Injection, powder, for solution
Injection, powder, for solutionSubcutaneous
Injection, powder, for solutionIntramuscular; Subcutaneous1200 IU
Injection, powder, for solutionIntramuscular; Subcutaneous600 IU
InjectionIntramuscular
Injection, powder, for solutionIntramuscular; Subcutaneous150 IU
Injection, solutionParenteral150 iu
Injection, solutionParenteral75 iu
Injection, powder, for solution1200 UI
Injection, powder, for solution600 UI
Injection, powder, for solutionParenteral75 IU
Powder, for solutionIntramuscular; Subcutaneous75 unit / vial
Injection, powder, for solution1200 IU
Injection, powder, for solution600 IU
Powder75 IU
Powder150 IU
Prices
Unit descriptionCostUnit
Repronex 5 75 unit Solution 1 Box Contains Five 1ml Vials488.04USD box
Menopur 75 unit vial93.85USD vial
Repronex 75 unit vial93.85USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Not Available

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)55 °CForastieri, H., Ingham, K.C. J. Biol. Chem. 257:7976-7981 (1982)
hydrophobicity-0.063Not Available
isoelectric point8.44Not Available

Targets

Drugtargets2
Build, predict & validate machine-learning models
Use our structured and evidence-based datasets to unlock new
insights and accelerate drug research.
Learn more
Use our structured and evidence-based datasets to unlock new insights and accelerate drug research.
Learn more
Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Binder
General Function
G-protein coupled peptide receptor activity
Specific Function
Receptor for follicle-stimulating hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Induces cAMP production through the activation of PI3K-AKT and S...
Gene Name
FSHR
Uniprot ID
P23945
Uniprot Name
Follicle-stimulating hormone receptor
Molecular Weight
78264.07 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [Article]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [Article]
  3. van de Weijer BH, Mulders JW, Bos ES, Verhaert PD, van den Hooven HW: Compositional analyses of a human menopausal gonadotrophin preparation extracted from urine (menotropin). Identification of some of its major impurities. Reprod Biomed Online. 2003 Nov;7(5):547-57. [Article]
  4. Olive DL: The role of gonadotropins in ovulation induction. Am J Obstet Gynecol. 1995 Feb;172(2 Pt 2):759-65. [Article]
  5. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [Article]
Kind
Protein
Organism
Humans
Pharmacological action
Yes
General Function
Luteinizing hormone receptor activity
Specific Function
Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
Gene Name
LHCGR
Uniprot ID
P22888
Uniprot Name
Lutropin-choriogonadotropic hormone receptor
Molecular Weight
78642.01 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [Article]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [Article]
  3. van de Weijer BH, Mulders JW, Bos ES, Verhaert PD, van den Hooven HW: Compositional analyses of a human menopausal gonadotrophin preparation extracted from urine (menotropin). Identification of some of its major impurities. Reprod Biomed Online. 2003 Nov;7(5):547-57. [Article]
  4. Olive DL: The role of gonadotropins in ovulation induction. Am J Obstet Gynecol. 1995 Feb;172(2 Pt 2):759-65. [Article]

Drug created on June 13, 2005 13:24 / Updated on October 18, 2021 04:56