Urokinase
Identification
- Name
- Urokinase
- Accession Number
- DB00013
- Description
Urokinase is an endogenous peptide that is cleaved in the presence of plasmin between lysine 158 and isoleucine 159 to yield active urokinase.2 Urokinase remains connected between these 2 chains by a sulfhydryl bond.2
Urokinase was granted FDA approval on 16 January 1978.3
- Type
- Biotech
- Groups
- Approved, Investigational, Withdrawn
- Biologic Classification
- Protein Based Therapies
Blood factors - Protein Structure
- Protein Chemical Formula
- C1376H2145N383O406S18
- Protein Average Weight
- 31126.5 Da
- Sequences
>DB00013 sequence KPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMS PCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHND IALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMT VVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVS WGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL
Download FASTA Format- Synonyms
- Kinase (enzyme-activating), uro-urokinase
- TCUK
- Tissue culture urokinase
- Two-chain urokinase
- Urochinasi
- Urokinase
- Urokinasum
- Uroquinasa
- External IDs
- WIN 22005
Pharmacology
- Indication
In Canada, urokinase is indicated for lysis of acute massive pulmonary emboli, acute thrombi obstructing coronary arteries, occlusive thromboemboli in peripheral arteries and grafts, and restoration of patency to intravenous catheters.4
- Associated Conditions
- Contraindications & Blackbox Warnings
Learn about our commercial Contraindications & Blackbox Warnings data.
Learn More- Pharmacodynamics
Urokinase is a serine protease that activates plasminogen to an active fibrinolytic protease.1 The duration of action is short due to the short half life.3 Patients should be counselled regarding the risk of bleeding, anaphylaxis, infusion reactions, and cholesterol embolization.[L12138
- Mechanism of action
Urokinase is a serine protease.1 It cleaves plasminogen to form the active fibrinolytic protease, plasmin.1
Target Actions Organism APlasminogen activatorHumans AUrokinase plasminogen activator surface receptor inducermodulatorHumans APlasminogen activator inhibitor 1 substrateinducerHumans APlasminogen activator inhibitor 2 substrateinducerHumans UPlasma serine protease inhibitor substrateHumans ULow-density lipoprotein receptor-related protein 2 substrateHumans USuppressor of tumorigenicity 14 protein substrateHumans UNidogen-1 ligandHumans - Absorption
Urokinase is delivered intravenously, so the bioavailability is high.
- Volume of distribution
The volume of distribution of urokinase is 11.5L.3
- Protein binding
Data regarding the protein binding of urokinase in plasma is not readily available.
- Metabolism
Because urokinase is a protein, it is expected to be metabolized by proteases to smaller proteins and amino acids.
- Route of elimination
Urokinase is eliminated in the bile and urine.3
- Half-life
Urokinase has a half life of 12.6±6.2 minutes.3
- Clearance
Data regarding the clearance of urokinase is not readily available.
- Adverse Effects
Learn about our commercial Adverse Effects data.
Learn More- Toxicity
Patients experiencing an overdose may present with bleeding.4 Treat patients with symptomatic and supportive measures which may include application of local pressure, administration of whole blood or plasma, and administration of aminocaproic acid.4
- Affected organisms
- Humans and other mammals
- Pathways
Pathway Category Urokinase Action Pathway Drug action - Pharmacogenomic Effects/ADRs
- Not Available
Interactions
- Drug Interactions
- This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
Drug Interaction Unlock Additional DataAbciximab Urokinase may increase the anticoagulant activities of Abciximab. Aceclofenac The risk or severity of bleeding and hemorrhage can be increased when Aceclofenac is combined with Urokinase. Acemetacin The risk or severity of bleeding and hemorrhage can be increased when Acemetacin is combined with Urokinase. Acenocoumarol Urokinase may increase the anticoagulant activities of Acenocoumarol. Acetylsalicylic acid Urokinase may increase the anticoagulant activities of Acetylsalicylic acid. Albutrepenonacog alfa The therapeutic efficacy of Albutrepenonacog alfa can be decreased when used in combination with Urokinase. Alclofenac The risk or severity of bleeding and hemorrhage can be increased when Alclofenac is combined with Urokinase. Aldesleukin The risk or severity of bleeding can be increased when Urokinase is combined with Aldesleukin. Alemtuzumab The risk or severity of bleeding can be increased when Urokinase is combined with Alemtuzumab. Alogliptin The risk or severity of angioedema can be increased when Urokinase is combined with Alogliptin. Additional Data Available- Extended DescriptionExtended DescriptionAvailable for Purchase
Extended description of the mechanism of action and particular properties of each drug interaction.
Learn more - SeveritySeverityAvailable for Purchase
A severity rating for each drug interaction, from minor to major.
Learn more - Evidence LevelEvidence LevelAvailable for Purchase
A rating for the strength of the evidence supporting each drug interaction.
Learn more - ActionActionAvailable for Purchase
An effect category for each drug interaction. Know how this interaction affects the subject drug.
Learn more
- Food Interactions
- Avoid herbs and supplements with anticoagulant/antiplatelet activity. Examples include garlic, ginger, bilberry, danshen, piracetam, and ginkgo biloba.
Products
- International/Other Brands
- Abbokinase (Abbott Laboratories)
- Brand Name Prescription Products
Name Dosage Strength Route Labeller Marketing Start Marketing End Region Image Unlock Additional DataKinlytic Injection, powder, lyophilized, for solution 250000 [iU]/5mL Intravenous ImaRx Therapeutics, Inc. 2007-06-08 Not applicable US Kinlytic (urokinase for Injection) Powder, for solution Intravenous Microbix Biosystems Inc 1988-12-31 2009-10-28 Canada Kinlytic Open-cath Powder, for solution Intravenous Microbix Biosystems Inc 1991-12-31 2009-10-28 Canada Additional Data Available- Application NumberApplication NumberAvailable for Purchase
A unique ID assigned by the FDA when a product is submitted for approval by the labeller.
Learn more - Product CodeProduct CodeAvailable for Purchase
A governmentally-recognized ID which uniquely identifies the product within its regulatory market.
Learn more
Categories
- ATC Codes
- B01AD04 — Urokinase
- Drug Categories
- Agents causing angioedema
- Amino Acids, Peptides, and Proteins
- Anticoagulants
- Biological Factors
- Blood and Blood Forming Organs
- Blood Proteins
- Endopeptidases
- Enzymes
- Enzymes and Coenzymes
- Fibrinolytic Agents
- Hydrolases
- Increased Thrombolysis
- Peptide Hydrolases
- Plasminogen Activators
- Proteins
- Serine Endopeptidases
- Serine Proteases
- Urokinase-Type Plasminogen Activator, antagonists & inhibitors
- Chemical TaxonomyProvided by Classyfire
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
Chemical Identifiers
- UNII
- 83G67E21XI
- CAS number
- 9039-53-6
References
- Synthesis Reference
Koji Sasaki, Yasukazu Harada, "Urokinase preparation for oral administration." U.S. Patent US4258030, issued November, 1975.
US4258030- General References
- Urano T, Castellino FJ, Suzuki Y: Regulation of plasminogen activation on cell surfaces and fibrin. J Thromb Haemost. 2018 May 20. doi: 10.1111/jth.14157. [PubMed:29779246]
- Kasai S, Arimura H, Nishida M, Suyama T: Primary structure of single-chain pro-urokinase. J Biol Chem. 1985 Oct 5;260(22):12382-9. [PubMed:2931434]
- FDA Approved Drug Products: Kinlytic Urokinase Injection (Discontinued) [Link]
- Health Canada Approved Drug Products: Urokinase Injection [Link]
- External Links
- UniProt
- P00749
- Genbank
- X02419
- PubChem Substance
- 46506299
- 11055
- ChEMBL
- CHEMBL1201420
- Therapeutic Targets Database
- DAP001194
- PharmGKB
- PA451836
- RxList
- RxList Drug Page
- Drugs.com
- Drugs.com Drug Page
- Wikipedia
- Urokinase
Clinical Trials
- Clinical Trials
Phase Status Purpose Conditions Count 4 Completed Treatment Pleural Diseases / Pleural Effusions / Pleural Empyema 1 4 Completed Treatment Pulmonary Embolism / Pulmonary Thromboembolism 1 4 Completed Treatment Pulmonary Embolism / Thromboembolism 1 4 Enrolling by Invitation Treatment Coronary Artery Disease (CAD) 1 3 Completed Treatment Acute Ischaemic Stroke 2 3 Completed Treatment Empyema / Pneumonia 1 3 Completed Treatment Infection / Patency 1 3 Not Yet Recruiting Treatment Minor Stroke 1 3 Terminated Treatment Arterial Occlusive Diseases / Diabetic Foot / Ischaemia 1 3 Terminated Treatment Critical Limb Ischemia (CLI) / Diabetic Foot 1
Pharmacoeconomics
- Manufacturers
- Microbix biosystems inc
- Packagers
- Hospira Inc.
- ImaRx Therapeutics
- Microbix Biosystems Inc.
- Dosage Forms
Form Route Strength Injection, powder, for solution 250000 unit/5mL Injection, powder, for solution 5000 unit/1mL Injection, powder, for solution Intravenous bolus; Intravenous drip; Intravitreal 100000 IU/2ML Injection, powder, for solution Intravenous bolus; Intravenous drip; Intravitreal 1000000 IU/5ML Injection, powder, for solution Intravenous bolus; Intravenous drip; Intravitreal 500000 IU/5ML Injection, powder, for solution Parenteral 250000 U.I./5ML Injection, powder, lyophilized, for solution Intravenous 250000 [iU]/5mL Powder, for solution Intravenous Solution 1000000 UI Solution 500000 UI Injection, powder, lyophilized, for solution Parenteral 500000 IU Injection, powder, for solution Intravenous 100000 IU Injection, powder, for solution Intravenous 1000000 IU Injection, powder, for solution Intravenous 25000 IU Injection, powder, for solution Intravenous 250000 IU Injection, powder, for solution Intravenous 500000 IU Injection, powder, for solution Intravenous bolus; Intravenous drip; Intravitreal 25000 IU/2ML Injection, powder, for solution Parenteral 1000.000 U.I./5ML Injection, powder, for solution Parenteral 500000 U.I./5ML Injection, powder, for solution 250000 unit Injection, powder, for solution 6000 unit Injection, powder, for solution 100000 U.I. Injection, powder, for solution 300000 U.I. Injection, powder, lyophilized, for solution Intra-arterial; Intravenous 250000 iu Injection, powder, lyophilized, for solution Intra-arterial; Intravenous 500000 iu Injection, powder, for solution Parenteral 50000 I.E. Injection, powder, for solution Parenteral 500000 I.E. Injection, powder, for solution 60000 iu Injection, powder, for solution Parenteral 1000.000 UI Powder, for solution Intravenous 500000 UI - Prices
- Not Available
- Patents
- Not Available
Properties
- State
- Liquid
- Experimental Properties
Property Value Source melting point (°C) 76 °C at pH 4.5 Nowak, U.K. et al., Biochemistry 33:2951-2960 (1994) hydrophobicity -0.466 Not Available isoelectric point 8.66 Not Available
Targets
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- Actions
- Activator
- General Function
- Serine-type peptidase activity
- Specific Function
- Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. In...
- Gene Name
- PLG
- Uniprot ID
- P00747
- Uniprot Name
- Plasminogen
- Molecular Weight
- 90568.415 Da
References
- Zhang X, Zhou H, Shen G, Liu Z, Hu Y, Wei W, Song S: Study on the mechanism of the annexin II-mediated co-assembly of t-PA and plasminogen. J Huazhong Univ Sci Technolog Med Sci. 2002;22(1):21-3, 76. [PubMed:12658774]
- Lopez-Alemany R, Longstaff C, Hawley S, Mirshahi M, Fabregas P, Jardi M, Merton E, Miles LA, Felez J: Inhibition of cell surface mediated plasminogen activation by a monoclonal antibody against alpha-Enolase. Am J Hematol. 2003 Apr;72(4):234-42. [PubMed:12666133]
- Hashimoto M, Oiwa K, Matsuo O, Ueshima S, Okada K, Okada Y, Okamoto S, Giddings JC, Yamamoto J: Suppression of argatroban-induced endogenous thrombolysis by PKSI-527, and antibodies to TPA and UPA, evaluated in a rat arterial thrombolysis model. Thromb Haemost. 2003 May;89(5):820-5. [PubMed:12719778]
- Guda K, Claffey KP, Dong M, Nambiar PR, Rosenberg DW: Defective processing of the transforming growth factor-beta1 in azoxymethane-induced mouse colon tumors. Mol Carcinog. 2003 May;37(1):51-9. [PubMed:12720300]
- Chang H, Shyu KG, Lin S, Wang BW, Liu YC, Lee CC: Cell adhesion induces the plasminogen activator inhibitor-1 gene expression through phosphatidylinositol 3-kinase/Akt activation in anchorage dependent cells. Cell Commun Adhes. 2002 Sep-Dec;9(5-6):239-47. [PubMed:12745435]
- Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
- FDA Approved Drug Products: Kinlytic Urokinase Injection (Discontinued) [Link]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- Actions
- InducerModulator
- General Function
- Urokinase plasminogen activator receptor activity
- Specific Function
- Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-...
- Gene Name
- PLAUR
- Uniprot ID
- Q03405
- Uniprot Name
- Urokinase plasminogen activator surface receptor
- Molecular Weight
- 36977.62 Da
References
- Czekay RP, Aertgeerts K, Curriden SA, Loskutoff DJ: Plasminogen activator inhibitor-1 detaches cells from extracellular matrices by inactivating integrins. J Cell Biol. 2003 Mar 3;160(5):781-91. [PubMed:12615913]
- Fuchs T, Allgayer H: Transcriptional regulation of the urokinase receptor (u-PAR)--a central molecule of invasion and metastasis. Biol Chem. 2003 May;384(5):755-61. [PubMed:12817472]
- Kanse SM, Chavakis T, Al-Fakhri N, Hersemeyer K, Monard D, Preissner KT: Reciprocal regulation of urokinase receptor (CD87)-mediated cell adhesion by plasminogen activator inhibitor-1 and protease nexin-1. J Cell Sci. 2004 Jan 26;117(Pt 3):477-85. Epub 2003 Dec 16. [PubMed:14679304]
- Beaufort N, Leduc D, Rousselle JC, Magdolen V, Luther T, Namane A, Chignard M, Pidard D: Proteolytic regulation of the urokinase receptor/CD87 on monocytic cells by neutrophil elastase and cathepsin G. J Immunol. 2004 Jan 1;172(1):540-9. [PubMed:14688365]
- Guerrero J, Santibanez JF, Gonzalez A, Martinez J: EGF receptor transactivation by urokinase receptor stimulus through a mechanism involving Src and matrix metalloproteinases. Exp Cell Res. 2004 Jan 1;292(1):201-8. [PubMed:14720519]
- Gutova M, Najbauer J, Gevorgyan A, Metz MZ, Weng Y, Shih CC, Aboody KS: Identification of uPAR-positive chemoresistant cells in small cell lung cancer. PLoS One. 2007 Feb 28;2(2):e243. [PubMed:17327908]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- Actions
- SubstrateInducer
- General Function
- Serine-type endopeptidase inhibitor activity
- Specific Function
- Serine protease inhibitor. This inhibitor acts as 'bait' for tissue plasminogen activator, urokinase, protein C and matriptase-3/TMPRSS7. Its rapid interaction with PLAT may function as a major con...
- Gene Name
- SERPINE1
- Uniprot ID
- P05121
- Uniprot Name
- Plasminogen activator inhibitor 1
- Molecular Weight
- 45059.695 Da
References
- Gamberi G, Serra M, Ragazzini P, Magagnoli G, Pazzaglia L, Ponticelli F, Ferrari C, Zanasi M, Bertoni F, Picci P, Benassi MS: Identification of markers of possible prognostic value in 57 giant cell tumors of bone. Oncol Rep. 2003 Mar-Apr;10(2):351-6. [PubMed:12579271]
- Shetty S, Bdeir K, Cines DB, Idell S: Induction of plasminogen activator inhibitor-1 by urokinase in lung epithelial cells. J Biol Chem. 2003 May 16;278(20):18124-31. Epub 2003 Mar 17. [PubMed:12642587]
- Hellgren M: Hemostasis during normal pregnancy and puerperium. Semin Thromb Hemost. 2003 Apr;29(2):125-30. [PubMed:12709915]
- Chang H, Shyu KG, Lin S, Wang BW, Liu YC, Lee CC: Cell adhesion induces the plasminogen activator inhibitor-1 gene expression through phosphatidylinositol 3-kinase/Akt activation in anchorage dependent cells. Cell Commun Adhes. 2002 Sep-Dec;9(5-6):239-47. [PubMed:12745435]
- Gerstein ES, Shcherbakov AM, Kaz'min AI, Ognerubov NA, Kushlinskii NE: [Urokinase and tissue type plasminogen activators and their type-1 inhibitor (PAI-1) in gastric cancer]. Vopr Onkol. 2003;49(2):165-9. [PubMed:12785198]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- Actions
- SubstrateInducer
- General Function
- Serine-type endopeptidase inhibitor activity
- Specific Function
- Inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1.
- Gene Name
- SERPINB2
- Uniprot ID
- P05120
- Uniprot Name
- Plasminogen activator inhibitor 2
- Molecular Weight
- 46595.84 Da
References
- Swartz JM, Bystrom J, Dyer KD, Nitto T, Wynn TA, Rosenberg HF: Plasminogen activator inhibitor-2 (PAI-2) in eosinophilic leukocytes. J Leukoc Biol. 2004 Oct;76(4):812-9. Epub 2004 Jul 26. [PubMed:15277569]
- Wygrecka M, Markart P, Ruppert C, Kuchenbuch T, Fink L, Bohle RM, Grimminger F, Seeger W, Gunther A: Compartment- and cell-specific expression of coagulation and fibrinolysis factors in the murine lung undergoing inhalational versus intravenous endotoxin application. Thromb Haemost. 2004 Sep;92(3):529-40. [PubMed:15351849]
- Iglesias D, Alegre J, Aleman C, Ruiz E, Soriano T, Armadans LI, Segura RM, Angles A, Monasterio J, de Sevilla TF: Metalloproteinases and tissue inhibitors of metalloproteinases in exudative pleural effusions. Eur Respir J. 2005 Jan;25(1):104-9. [PubMed:15640330]
- Grebenchtchikov N, Maguire TM, Riisbro R, Geurts-Moespot A, O'Donovan N, Schmitt M, McGreal G, McDermott E, O'Higgins N, Brunner N, Sweep CG, Duffy MJ: Measurement of plasminogen activator system components in plasma and tumor tissue extracts obtained from patients with breast cancer: an EORTC Receptor and Biomarker Group collaboration. Oncol Rep. 2005 Jul;14(1):235-9. [PubMed:15944795]
- Fernandez-Soria V, Lleonart ME, Diaz-Fuertes M, Villuendas R, Sanchez-Prieto R, Fabra A, Ramon Y Cajal S: Adenovirus E1A orchestrates the urokinase-plasminogen activator system and upregulates PAI-2 expression, supporting a tumor suppressor effect. Int J Oncol. 2006 Jan;28(1):143-8. [PubMed:16327990]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Unknown
- Actions
- Substrate
- General Function
- Serine-type endopeptidase inhibitor activity
- Specific Function
- Heparin-dependent serine protease inhibitor acting in body fluids and secretions. Inactivates serine proteases by binding irreversibly to their serine activation site. Involved in the regulation of...
- Gene Name
- SERPINA5
- Uniprot ID
- P05154
- Uniprot Name
- Plasma serine protease inhibitor
- Molecular Weight
- 45674.315 Da
References
- Uhrin P, Schofer C, Zaujec J, Ryban L, Hilpert M, Weipoltshammer K, Jerabek I, Pirtzkall I, Furtmuller M, Dewerchin M, Binder BR, Geiger M: Male fertility and protein C inhibitor/plasminogen activator inhibitor-3 (PCI): localization of PCI in mouse testis and failure of single plasminogen activator knockout to restore spermatogenesis in PCI-deficient mice. Fertil Steril. 2007 Oct;88(4 Suppl):1049-57. Epub 2007 Apr 16. [PubMed:17434507]
- Espana F, Navarro S, Medina P, Zorio E, Estelles A: The role of protein C inhibitor in human reproduction. Semin Thromb Hemost. 2007 Feb;33(1):41-5. [PubMed:17253188]
- Odet F, Guyot R, Leduque P, Le Magueresse-Battistoni B: Evidence for similar expression of protein C inhibitor and the urokinase-type plasminogen activator system during mouse testis development. Endocrinology. 2004 Mar;145(3):1481-9. Epub 2003 Nov 26. [PubMed:14645112]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Unknown
- Actions
- Substrate
- Curator comments
- Low-density lipoprotein receptor-related protein 2 mediates endocytosis of urokinase.
- General Function
- Calcium ion binding
- Specific Function
- Acts together with cubilin to mediate HDL endocytosis (By similarity). May participate in regulation of parathyroid-hormone and para-thyroid-hormone-related protein release.
- Gene Name
- LRP2
- Uniprot ID
- P98164
- Uniprot Name
- Low-density lipoprotein receptor-related protein 2
- Molecular Weight
- 521952.77 Da
References
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
- Kanalas JJ: Effect of the nephritogenic autoantibody of Heymann's nephritis on plasminogen-binding to gp330 and activation by urokinase. Biochim Biophys Acta. 1993 Nov 25;1225(1):101-6. [PubMed:8241286]
- Kanalas JJ: Analysis of plasmin binding and urokinase activation of plasminogen bound to the Heymann nephritis autoantigen, gp330. Arch Biochem Biophys. 1992 Dec;299(2):255-60. [PubMed:1280065]
- Korenberg JR, Argraves KM, Chen XN, Tran H, Strickland DK, Argraves WS: Chromosomal localization of human genes for the LDL receptor family member glycoprotein 330 (LRP2) and its associated protein RAP (LRPAP1). Genomics. 1994 Jul 1;22(1):88-93. [PubMed:7959795]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Unknown
- Actions
- Substrate
- Curator comments
- Suppressor of tumorigenicity 14 protein activates urokinase.
- General Function
- Serine-type peptidase activity
- Specific Function
- Degrades extracellular matrix. Proposed to play a role in breast cancer invasion and metastasis. Exhibits trypsin-like activity as defined by cleavage of synthetic substrates with Arg or Lys as the...
- Gene Name
- ST14
- Uniprot ID
- Q9Y5Y6
- Uniprot Name
- Suppressor of tumorigenicity 14 protein
- Molecular Weight
- 94769.01 Da
References
- Suzuki M, Kobayashi H, Kanayama N, Saga Y, Suzuki M, Lin CY, Dickson RB, Terao T: Inhibition of tumor invasion by genomic down-regulation of matriptase through suppression of activation of receptor-bound pro-urokinase. J Biol Chem. 2004 Apr 9;279(15):14899-908. Epub 2004 Jan 27. [PubMed:14747469]
- Kirchhofer D, Peek M, Li W, Stamos J, Eigenbrot C, Kadkhodayan S, Elliott JM, Corpuz RT, Lazarus RA, Moran P: Tissue expression, protease specificity, and Kunitz domain functions of hepatocyte growth factor activator inhibitor-1B (HAI-1B), a new splice variant of HAI-1. J Biol Chem. 2003 Sep 19;278(38):36341-9. Epub 2003 Jun 18. [PubMed:12815039]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Unknown
- Actions
- Ligand
- General Function
- Proteoglycan binding
- Specific Function
- Sulfated glycoprotein widely distributed in basement membranes and tightly associated with laminin. Also binds to collagen IV and perlecan. It probably has a role in cell-extracellular matrix inter...
- Gene Name
- NID1
- Uniprot ID
- P14543
- Uniprot Name
- Nidogen-1
- Molecular Weight
- 136375.93 Da
References
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
- Stephens RW, Aumailley M, Timpl R, Reisberg T, Tapiovaara H, Myohanen H, Murphy-Ullrich J, Vaheri A: Urokinase binding to laminin-nidogen. Structural requirements and interactions with heparin. Eur J Biochem. 1992 Aug 1;207(3):937-42. [PubMed:1499567]
Enzymes
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Unknown
- Actions
- Substrate
- General Function
- Zinc ion binding
- Specific Function
- May be involved in tissue injury and remodeling. Has significant elastolytic activity. Can accept large and small amino acids at the P1' site, but has a preference for leucine. Aromatic or hydropho...
- Gene Name
- MMP12
- Uniprot ID
- P39900
- Uniprot Name
- Macrophage metalloelastase
- Molecular Weight
- 54001.175 Da
References
- Andolfo A, English WR, Resnati M, Murphy G, Blasi F, Sidenius N: Metalloproteases cleave the urokinase-type plasminogen activator receptor in the D1-D2 linker region and expose epitopes not present in the intact soluble receptor. Thromb Haemost. 2002 Aug;88(2):298-306. [PubMed:12195704]
Drug created on June 13, 2005 07:24 / Updated on November 02, 2020 20:49