Nivolumab

Identification

Name
Nivolumab
Accession Number
DB09035
Description

Nivolumab is a fully human IgG4 antibody targeting the immune checkpoint programmed death receptor-1 (PD-1).6 This antibody was produced entirely in mice and grafted onto human kappa and IgG4 Fc region with the mutation S228P for additional stability and reduced variability.5 It was developed by Bristol Myers Squibb.6

Nivolumab was granted FDA approval on 22 December 2014.6

Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Protein Structure
Db09035
Protein Chemical Formula
C6362H9862N1712O1995S42
Protein Average Weight
143597.3811 Da
Sequences
>Heavy Chain Sequence
QVQLVESGGGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYY
ADSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSASTKGPS
VFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS
VVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKP
KDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLT
VLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV
MHEALHNHYTQKSLSLSLGK
>Light Chain Sequence
EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA
RFSGSGSGTDFTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
Synonyms
  • Nivolumab
External IDs
  • BMS 936558
  • BMS-936558
  • GTPL7335
  • MDX 1106
  • MDX-1106
  • ONO 4538
  • ONO-4538

Pharmacology

Indication

Nivolumab is indicated to treat unresectable or metastatic melanoma, adjuvant treatment of melanoma, metastatic non-small cell lung cancer, small cell lung cancer, advanced renal cell carcinoma, classical Hodgkin lymphoma, squamous cell carcinoma of the head and neck, urothelial carcinoma, microsatellite instability-high or mismatch repair deficient metastatic colorectal cancer, and hepatocellular carcinoma.6

Associated Conditions
Associated Therapies
Contraindications & Blackbox Warnings
Learn about our commercial Contraindications & Blackbox Warnings data.
Learn More
Pharmacodynamics

Nivolumab blocks PD-1 inhibitory signalling to T-cells.6 It has a long duration of action as it is administered every 2-4 weeks.6 Patients should be counselled regarding the risk of immune-mediated adverse effects, infusion-related adverse effects, complications of allogenic hematopoietic stem cell transplants, embryo-fetal toxicity.6

Mechanism of action

The ligands PD-L1 and PD-L2 bind to the PD-1 receptor on T-cells, inhibiting the action of these cells.6 Tumor cells express PD-L1 and PD-L2.6 Nivolumab binds to PD-1, preventing PD-L1 and PD-L2 from inhibiting the action of T-cells, restoring a patient's tumor-specific T-cell response.1

TargetActionsOrganism
AProgrammed cell death protein 1
inhibitor
antibody
Humans
Absorption

Pharmacokinetic studies have suggested that nivolumab presents linear pharmacokinetics with a dose-proportional increase in peak concentration and AUC. The time to peak plasma concentration ranges between 1-4 hours.1 The absorption pharmacokinetic properties respective to the administration of a dose of 10 mg/kg are reported to be Cmax, Tmax and AUC of 242 µg/kg, 2.99 hours and 68100 µg*h/mL respectively.3

Volume of distribution

The volume of distribution at steady state when a dose of 10 mg/kg of nivolumab is administered is reported to be 91.1 mL/kg.3 At doses ranging from 0.1 to 20 mg/kg the volume of distribution is reported to be 8L.4

Protein binding

There is no information regarding the plasma protein binding of nivolumab.7

Metabolism

There have not been formal studies regarding the specific metabolism of nivolumab but as a human monoclonal antibody, it has been suggested to be degraded to small peptides and individual amino acids.7

Route of elimination

There have not been studies regarding the specific route of elimination of nivolumab.7

Half-life

The serum half life of nivolumab is approximately 20 days1 with an elimination half life of 26.7 days.4

Clearance

The estimated clearance rate of nivolumab is 9.4 mL/h.2 The clearance rate seems to be increased according to body weight.4

Adverse Effects
Learn about our commercial Adverse Effects data.
Learn More
Toxicity

Data regarding overdoses of nivolumab are not readily available.6 Common adverse effects include Rash, pruritus, cough, upper respiratory tract infection, and peripheral edema.6

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Nivolumab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Nivolumab.
AlemtuzumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Nivolumab.
AlirocumabThe risk or severity of adverse effects can be increased when Nivolumab is combined with Alirocumab.
Anthrax immune globulin humanThe risk or severity of adverse effects can be increased when Nivolumab is combined with Anthrax immune globulin human.
Antilymphocyte immunoglobulin (horse)The risk or severity of adverse effects can be increased when Nivolumab is combined with Antilymphocyte immunoglobulin (horse).
Antithymocyte immunoglobulin (rabbit)The risk or severity of adverse effects can be increased when Antithymocyte immunoglobulin (rabbit) is combined with Nivolumab.
Asfotase alfaThe risk or severity of adverse effects can be increased when Nivolumab is combined with Asfotase alfa.
AtezolizumabThe risk or severity of adverse effects can be increased when Nivolumab is combined with Atezolizumab.
AvelumabThe risk or severity of adverse effects can be increased when Nivolumab is combined with Avelumab.
Additional Data Available
  • Extended Description
    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
No interactions found.

Products

Brand Name Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing EndRegionImage
OpdivoSolution10 mgIntravenousBristol Myers Squibb2015-10-23Not applicableCanada flag
OpdivoInjection10 mg/1mLIntravenousE.R. Squibb & Sons, L.L.C.2014-12-22Not applicableUS flag
OpdivoInjection10 mg/1mLIntravenousE.R. Squibb & Sons, L.L.C.2017-12-08Not applicableUS flag
OpdivoSolution10 mgIntravenousBristol Myers Squibb2015-10-23Not applicableCanada flag
OpdivoInjection10 mg/1mLIntravenousE.R. Squibb & Sons, L.L.C.2014-12-22Not applicableUS flag
Additional Data Available
  • Application Number
    Application Number

    A unique ID assigned by the FDA when a product is submitted for approval by the labeller.

    Learn more
  • Product Code
    Product Code

    A governmentally-recognized ID which uniquely identifies the product within its regulatory market.

    Learn more

Categories

ATC Codes
L01XC17 — Nivolumab
Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Chemical Identifiers

UNII
31YO63LBSN
CAS number
946414-94-4

References

General References
  1. Brahmer JR, Hammers H, Lipson EJ: Nivolumab: targeting PD-1 to bolster antitumor immunity. Future Oncol. 2015;11(9):1307-26. doi: 10.2217/fon.15.52. Epub 2015 Mar 23. [PubMed:25798726]
  2. Bajaj G, Wang X, Agrawal S, Gupta M, Roy A, Feng Y: Model-Based Population Pharmacokinetic Analysis of Nivolumab in Patients With Solid Tumors. CPT Pharmacometrics Syst Pharmacol. 2017 Jan;6(1):58-66. doi: 10.1002/psp4.12143. Epub 2016 Dec 26. [PubMed:28019091]
  3. Lee KW, Lee DH, Kang JH, Park JO, Kim SH, Hong YS, Kim ST, Oh DY, Bang YJ: Phase I Pharmacokinetic Study of Nivolumab in Korean Patients with Advanced Solid Tumors. Oncologist. 2018 Feb;23(2):155-e17. doi: 10.1634/theoncologist.2017-0528. Epub 2017 Nov 20. [PubMed:29158363]
  4. Solimando DA Jr, Waddell JA: Nivolumab and Olaparib. Hosp Pharm. 2015 May;50(5):356-66. doi: 10.1310/hpj5005-356. [PubMed:26405320]
  5. Mashima E, Inoue A, Sakuragi Y, Yamaguchi T, Sasaki N, Hara Y, Omoto D, Ohmori S, Haruyama S, Sawada Y, Yoshioka M, Nishio D, Nakamura M: Nivolumab in the treatment of malignant melanoma: review of the literature. Onco Targets Ther. 2015 Aug 6;8:2045-51. doi: 10.2147/OTT.S62102. eCollection 2015. [PubMed:26273207]
  6. FDA Approved Drug Products: Opvido Nivolumab Intravenous Injection [Link]
  7. BC Cancer Agency: Opdivo Monograph [Link]
KEGG Drug
D10316
PubChem Substance
347910393
RxNav
1597876
ChEMBL
CHEMBL2108738
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Nivolumab
AHFS Codes
  • 10:00.00 — Antineoplastic Agents
FDA label
Download (2.51 MB)
MSDS
Download (1.26 MB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
4Active Not RecruitingOtherRenal Cell Adenocarcinoma1
4Active Not RecruitingTreatmentLung Cancers1
4Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
4CompletedTreatmentNeoplasms, Kidney / Non-Small Cell Lung Carcinoma (NSCLC) / Renal Cancers / Renal Neoplasms1
4Not Yet RecruitingDiagnosticLung Cancers / Melanoma / Non-small Cell1
4Not Yet RecruitingTreatmentMetastatic Non-Small Cell Lung Cancer1
4Not Yet RecruitingTreatmentRenal Cancers1
4Unknown StatusOtherMetastatic Melanoma1
3Active Not RecruitingTreatmentAdvanced Non Small Cell Lung Cancer1
3Active Not RecruitingTreatmentAdvanced or Metastatic (Medically or Surgically Unresectable) Clear-cell Renal Cell Carcinoma1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage Forms
FormRouteStrength
Injection, solution, concentrateIntravenous10 MG/ML
InjectionIntravenous10 mg/1mL
Injection, solution, concentrateIntravenous100 mg/10mL
Injection, solution, concentrateIntravenous40 mg/4mL
Injection, solution, concentrateIntravenous; Parenteral10 MG/ML
SolutionIntravenous10 mg
SolutionIntravenous100 mg/10ml
Injection, solution
SolutionIntravenous40 mg/4ml
SolutionIntravenous40 mg
SolutionIntravenous100 mg
Prices
Not Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)Region
US2013173223No2013-05-132033-05-13US flag
Additional Data Available
  • Filed On
    Filed On

    The date on which a patent was filed with the relevant government.

    Learn more

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)80-90 ºC (based on IgG properties)McConnell A., et al. (2014). MAbs. Sep-Oct; 6 (5); 1274-1282
boiling point (°C)Fab and Fc domains denaturates at 60 and 70 ºC respectivelyArnoldus W. et al. (2000). Biophysical Journal. Vol 78. 394-404
water solubility50 mg/mlHuman IgG purified. Product Information
isoelectric point6.1-8.5 Agrisera Information about IgG antibodies.

Targets

Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Inhibitor
Antibody
General Function
Signal transducer activity
Specific Function
Inhibitory cell surface receptor involved in the regulation of T-cell function during immunity and tolerance. Upon ligand binding, inhibits T-cell effector functions in an antigen-specific manner. ...
Gene Name
PDCD1
Uniprot ID
Q15116
Uniprot Name
Programmed cell death protein 1
Molecular Weight
31646.635 Da
References
  1. Taneja SS: Re: Safety, activity, and immune correlates of anti-PD-1 antibody in cancer. J Urol. 2012 Dec;188(6):2149. [PubMed:23289116]

Drug created on February 24, 2015 16:02 / Updated on October 25, 2020 09:16

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Logo pink
Stay in the know!
As part of our commitment to providing the most up-to-date drug information, we will be releasing #DrugBankUpdates with our newly added curated drug pages.
#DrugBankUpdates