Sermorelin

Identification

Generic Name
Sermorelin
DrugBank Accession Number
DB00010
Background

Sermorelin acetate is the acetate salt of an amidated synthetic 29-amino acid peptide (GRF 1-29 NH 2 ) that corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone (GHRH or GRF) consisting of 44 amino acid residues

Type
Biotech
Groups
Approved, Withdrawn
Biologic Classification
Protein Based Therapies
Hormones
Protein Chemical Formula
C149H246N44O42S
Protein Average Weight
3357.882 Da
Sequences
>DB00010 sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQ
Download FASTA Format
Synonyms
  • Sermorelin

Pharmacology

Indication

For the treatment of dwarfism, prevention of HIV-induced weight loss

Pharmacology
Accelerate your drug discovery research with the industry’s only fully connected ADMET dataset, ideal for:
Machine Learning
Data Science
Drug Discovery
Accelerate your drug discovery research with our fully connected ADMET dataset
Learn more
Contraindications & Blackbox Warnings
Contraindications
Contraindications & Blackbox Warnings
With our commercial data, access important information on dangerous risks, contraindications, and adverse effects.
Learn more
Our Blackbox Warnings cover Risks, Contraindications, and Adverse Effects
Learn more
Pharmacodynamics

Sermorelin is used in the treatment of children with growth hormone deficiency or growth failure. Geref increases plasma growth hormone (GH) concentration by stimulating the pituitary gland to release GH. Geref is similar to the full-length native hormone (44 residues) in its ability to stimulate GH secretion in humans.

Mechanism of action

Sermorelin binds to the growth hormone releasing hormone receptor and mimics native GRF in its ability to stimulate growth hormone secretion.

TargetActionsOrganism
AGrowth hormone-releasing hormone receptor
agonist
Humans
Absorption

Not Available

Volume of distribution

Not Available

Protein binding

Not Available

Metabolism
Not Available
Route of elimination

Not Available

Half-life

11-12 min

Clearance

Not Available

Adverse Effects
Medicalerrors
Reduce medical errors
and improve treatment outcomes with our comprehensive & structured data on drug adverse effects.
Learn more
Reduce medical errors & improve treatment outcomes with our adverse effects data
Learn more
Toxicity

Not Available

Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
No interactions found.
Food Interactions
Not Available

Products

Products
Comprehensive & structured drug product info
From application numbers to product codes, connect different identifiers through our commercial datasets.
Learn more
Easily connect various identifiers back to our datasets
Learn more
Product Ingredients
IngredientUNIICASInChI Key
Sermorelin acetate00IBG87IQW114466-38-5Not applicable
International/Other Brands
Geref (Serono Pharma)

Categories

ATC Codes
V04CD03 — SermorelinH01AC04 — Sermorelin
Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available
Affected organisms
  • Humans and other mammals

Chemical Identifiers

UNII
89243S03TE
CAS number
86168-78-7

References

General References
Not Available
KEGG Compound
C08192
PubChem Substance
46507399
RxNav
56188
Therapeutic Targets Database
DAP001055
PharmGKB
PA164749110
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Sermorelin

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount

Pharmacoeconomics

Manufacturers
  • Emd serono inc
Packagers
  • Chengdu Shengnuo Bio Pharmaceutical Co. Ltd.
  • Letco Medical Inc.
  • Live Well Drugstore LLC
Dosage Forms
FormRouteStrength
Injection, powder, for solutionIntravenous
Prices
Not Available
Patents
Not Available

Properties

State
Liquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.330Not Available
isoelectric point9.99Not Available

Targets

Drugtargets
Accelerate your drug discovery research
with our fully connected ADMET & drug target dataset.
Learn more
Accelerate your drug discovery research with our ADMET & drug target dataset
Learn more
Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Agonist
General Function
Peptide hormone binding
Specific Function
Receptor for GRF, coupled to G proteins which activate adenylyl cyclase. Stimulates somatotroph cell growth, growth hormone gene transcription and growth hormone secretion.
Gene Name
GHRHR
Uniprot ID
Q02643
Uniprot Name
Growth hormone-releasing hormone receptor
Molecular Weight
47401.53 Da
References
  1. Esposito P, Barbero L, Caccia P, Caliceti P, D'Antonio M, Piquet G, Veronese FM: PEGylation of growth hormone-releasing hormone (GRF) analogues. Adv Drug Deliv Rev. 2003 Sep 26;55(10):1279-91. [Article]
  2. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [Article]

Drug created on June 13, 2005 13:24 / Updated on April 03, 2021 09:32