Sermorelin
Identification
- Name
- Sermorelin
- Accession Number
- DB00010
- Description
Sermorelin acetate is the acetate salt of an amidated synthetic 29-amino acid peptide (GRF 1-29 NH 2 ) that corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone (GHRH or GRF) consisting of 44 amino acid residues
- Type
- Biotech
- Groups
- Approved, Withdrawn
- Biologic Classification
- Protein Based Therapies
Hormones - Protein Chemical Formula
- C149H246N44O42S
- Protein Average Weight
- 3357.882 Da
- Sequences
>DB00010 sequence YADAIFTNSYRKVLGQLSARKLLQDIMSRQ
Download FASTA Format- Synonyms
- Sermorelin
Pharmacology
- Accelerate your drug discovery research with the industry’s only fully connected ADMET dataset, ideal for:Accelerate your drug discovery research with our fully connected ADMET dataset
- Indication
For the treatment of dwarfism, prevention of HIV-induced weight loss
- Contraindications & Blackbox Warnings
- Contraindications & Blackbox WarningsWith our commercial data, access important information on dangerous risks, contraindications, and adverse effects.Our Blackbox Warnings cover Risks, Contraindications, and Adverse Effects
- Pharmacodynamics
Sermorelin is used in the treatment of children with growth hormone deficiency or growth failure. Geref increases plasma growth hormone (GH) concentration by stimulating the pituitary gland to release GH. Geref is similar to the full-length native hormone (44 residues) in its ability to stimulate GH secretion in humans.
- Mechanism of action
Sermorelin binds to the growth hormone releasing hormone receptor and mimics native GRF in its ability to stimulate growth hormone secretion.
Target Actions Organism AGrowth hormone-releasing hormone receptor agonistHumans - Absorption
- Not Available
- Volume of distribution
- Not Available
- Protein binding
- Not Available
- Metabolism
- Not Available
- Route of elimination
- Not Available
- Half-life
11-12 min
- Clearance
- Not Available
- Adverse Effects
- Reduce medical errorsand improve treatment outcomes with our comprehensive & structured data on drug adverse effects.Reduce medical errors & improve treatment outcomes with our adverse effects data
- Toxicity
- Not Available
- Affected organisms
- Humans and other mammals
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRs
- Not Available
Interactions
- Drug Interactions
- This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.No interactions found.
- Food Interactions
- Not Available
Products
- Comprehensive & structured drug product infoFrom application numbers to product codes, connect different identifiers through our commercial datasets.Easily connect various identifiers back to our datasets
- Product Ingredients
Ingredient UNII CAS InChI Key Sermorelin acetate 00IBG87IQW 114466-38-5 Not applicable - International/Other Brands
- Geref (Serono Pharma)
Categories
- ATC Codes
- V04CD03 — Sermorelin
- V04CD — Tests for pituitary function
- V04C — OTHER DIAGNOSTIC AGENTS
- V04 — DIAGNOSTIC AGENTS
- V — VARIOUS
- Drug Categories
- Amino Acids, Peptides, and Proteins
- Anterior Pituitary Lobe Hormones and Analogues
- Diagnostic Agents
- Growth Hormone-Releasing Hormone
- Hormones
- Hormones, Hormone Substitutes, and Hormone Antagonists
- Hypothalamic Hormones
- Nerve Tissue Proteins
- Neuropeptides
- Peptide Hormones
- Peptides
- Pituitary and Hypothalamic Hormones and Analogues
- Pituitary Hormone-Releasing Hormones
- Somatropin and Somatropin Agonists
- Systemic Hormonal Preparations, Excl. Sex Hormones and Insulins
- Tests for Pituitary Function
- Chemical TaxonomyProvided by Classyfire
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
Chemical Identifiers
- UNII
- 89243S03TE
- CAS number
- 86168-78-7
References
- General References
- Not Available
- External Links
- KEGG Compound
- C08192
- PubChem Substance
- 46507399
- 56188
- Therapeutic Targets Database
- DAP001055
- PharmGKB
- PA164749110
- RxList
- RxList Drug Page
- Drugs.com
- Drugs.com Drug Page
- Wikipedia
- Sermorelin
Clinical Trials
Pharmacoeconomics
- Manufacturers
- Emd serono inc
- Packagers
- Chengdu Shengnuo Bio Pharmaceutical Co. Ltd.
- Letco Medical Inc.
- Live Well Drugstore LLC
- Dosage Forms
Form Route Strength Injection, powder, for solution Intravenous - Prices
- Not Available
- Patents
- Not Available
Properties
- State
- Liquid
- Experimental Properties
Property Value Source hydrophobicity -0.330 Not Available isoelectric point 9.99 Not Available
Targets

- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- Actions
- Agonist
- General Function
- Peptide hormone binding
- Specific Function
- Receptor for GRF, coupled to G proteins which activate adenylyl cyclase. Stimulates somatotroph cell growth, growth hormone gene transcription and growth hormone secretion.
- Gene Name
- GHRHR
- Uniprot ID
- Q02643
- Uniprot Name
- Growth hormone-releasing hormone receptor
- Molecular Weight
- 47401.53 Da
References
- Esposito P, Barbero L, Caccia P, Caliceti P, D'Antonio M, Piquet G, Veronese FM: PEGylation of growth hormone-releasing hormone (GRF) analogues. Adv Drug Deliv Rev. 2003 Sep 26;55(10):1279-91. [PubMed:14499707]
- Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
Drug created on June 13, 2005 13:24 / Updated on April 03, 2021 09:32