Thyrotropin alfa

Identification

Name
Thyrotropin alfa
Accession Number
DB00024
Description

Thyrotropin alfa is a recombinant form of thyroid stimulating hormone used in performing certain tests in patients who have or have had thyroid cancer. It is also used along with a radioactive agent to destroy remaining thyroid tissue in certain patients who have had their thyroid gland removed because of thyroid cancer. It is a heterodimeric glycoprotein comprised of two non-covalently linked subunits, an alpha subunit of 92 amino acid residues containing two N-linked glycosylation sites and a beta subunit of 112 residues containing one N-linked glycosylation site. The alpha subunit of thyrotropin alfa, which is the effector region responsible for the stimulation of adenylate cyclase, displays close structural similarity with the alpha subunit of human chorionic gonadotropin (hCG), luteinizing hormone (LH), and follicle-stimulating hormone (FSH). The beta subunit (TSHB) bestows its receptor specificity due to the uniqueness to TSH. The amino acid sequence of thyrotropin alfa is identical to that of human pituitary thyroid stimulating hormone.

Type
Biotech
Groups
Approved, Vet approved
Biologic Classification
Protein Based Therapies
Hormones
Protein Structure
Db00024
Protein Chemical Formula
C975H1513N267O304S26
Protein Average Weight
22672.9 Da
Sequences
>Alpha chain
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC
VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
>Beta chain
FCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYR
TVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSY
Download FASTA Format
Synonyms
  • Recombinant Human Thyroid Stimulating Hormone
  • Recombinant thyrotropin alfa
  • rhTSH
  • rTSH
  • Thyrotropin alpha
External IDs
  • GX-30

Pharmacology

Indication

For detection of residueal or recurrent thyroid cancer

Associated Conditions
Associated Therapies
Contraindications & Blackbox Warnings
Learn about our commercial Contraindications & Blackbox Warnings data.
Learn More
Pharmacodynamics

Binding of thyrotropin alfa to TSH receptors on normal thyroid epithelial cells or on well-differentiated thyroid cancer tissue stimulates iodine uptake and organification. Thyrogen is an exogenous source of human TSH that offers an additional diagnostic tool in the follow-up of patients with a history of well-differentiated thyroid cancer.

Mechanism of action

Thyrotropin Alfa binds to the thyrotropin receptors found on any residual thyroid cells or tissues. This stimulates radioactive iodine uptake for better radiodiagnostic imaging.

TargetActionsOrganism
AThyrotropin receptor
agonist
Humans
Absorption

Time to peak: Median: 10 hours (range: 3-24 hours) After a single intramuscular injection of 0.9 mg of thyrotropin alfa: Cmax= 116+38mU/L, Tmax=22+8.5 hours. AUC=5088+1728 mU·hr/L.

Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination

kidney and liver

Half-life

25 ± 10 hours

Clearance
Not Available
Adverse Effects
Learn about our commercial Adverse Effects data.
Learn More
Toxicity

No difference in efficacy and toxicity between adult and geriatric patients. No studies in lactating women, pregnant women and pediatrics. Cautionary administration is advised.

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
AcalabrutinibThe therapeutic efficacy of Thyrotropin alfa can be decreased when used in combination with Acalabrutinib.
AcarboseThyrotropin alfa may decrease the hypoglycemic activities of Acarbose.
AcebutololThe therapeutic efficacy of Thyrotropin alfa can be decreased when used in combination with Acebutolol.
AcenocoumarolThe risk or severity of bleeding can be increased when Thyrotropin alfa is combined with Acenocoumarol.
AcetohexamideThyrotropin alfa may decrease the hypoglycemic activities of Acetohexamide.
Acetylsalicylic acidThe therapeutic efficacy of Thyrotropin alfa can be increased when used in combination with Acetylsalicylic acid.
AfatinibThe therapeutic efficacy of Thyrotropin alfa can be decreased when used in combination with Afatinib.
AlbiglutideThyrotropin alfa may decrease the hypoglycemic activities of Albiglutide.
AldesleukinThe therapeutic efficacy of Thyrotropin alfa can be decreased when used in combination with Aldesleukin.
AlectinibThe therapeutic efficacy of Thyrotropin alfa can be decreased when used in combination with Alectinib.
Additional Data Available
  • Extended Description
    Extended Description
    Available for Purchase

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity
    Available for Purchase

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level
    Available for Purchase

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action
    Available for Purchase

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
Not Available

Products

Purchasing individual compounds or compound libraries for your research?
Learn More
Brand Name Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing EndRegionImage
ThyrogenInjection, powder, for solution0.9 mg/1mLIntramuscularGenzyme Corporation1998-11-30Not applicableUS flag
ThyrogenPowder, for solution0.9 mgIntramuscularSanofi Genzyme, a Division of Sanofi Aventis Canada Inc2002-08-12Not applicableCanada flag
ThyrogenInjection0.9 mg/1mLIntramuscularGenzyme Corporation1998-11-302019-05-30US flag
Additional Data Available
  • Application Number
    Application Number
    Available for Purchase

    A unique ID assigned by the FDA when a product is submitted for approval by the labeller.

    Learn more
  • Product Code
    Product Code
    Available for Purchase

    A governmentally-recognized ID which uniquely identifies the product within its regulatory market.

    Learn more

Categories

ATC Codes
H01AB01 — Thyrotropin alfa
Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Chemical Identifiers

UNII
AVX3D5A4LM
CAS number
194100-83-9

References

Synthesis Reference

19366632

General References
Not Available
UniProt
P01225
Genbank
M16647
PubChem Substance
46505696
RxNav
4952
ChEMBL
CHEMBL1201533
Therapeutic Targets Database
DAP001248
PharmGKB
PA164746560
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Thyroid-stimulating_hormone
AHFS Codes
  • 36:60.00 — Thyroid Function
FDA label
Download (2.27 MB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
4CompletedTreatmentHypothyroidism / Neoplasms, Thyroid1
4CompletedTreatmentThyroid Cancers1
3CompletedNot AvailableNeoplasms, Thyroid1
3CompletedTreatmentDifferentiated Thyroid Cancer (DTC)1
3RecruitingOtherLow Risk Differentiated Thyroid Cancer1
3Unknown StatusTreatmentThyroid Cancers1
2CompletedDiagnosticThyroid Cancers1
2CompletedTreatmentBenign Nontoxic and Toxic Goiter / Graves' Disease1
2CompletedTreatmentGoiter, Nodular1
2CompletedTreatmentRecurrent Thyroid Cancer / Stage IVA Follicular Thyroid Cancer / Stage IVA Papillary Thyroid Cancer / Stage IVB Follicular Thyroid Cancer / Stage IVB Papillary Thyroid Cancer / Stage IVC Follicular Thyroid Cancer / Stage IVC Papillary Thyroid Cancer1

Pharmacoeconomics

Manufacturers
  • Sanofi aventis us llc
  • Genzyme corp
Packagers
  • Genzyme Inc.
  • Organon Pharmaceuticals
Dosage Forms
FormRouteStrength
InjectionIntramuscular0.9 mg/1mL
Injection, powder, for solution1.1 MG
Injection, powder, for solutionIntramuscular0.9 mg/1mL
Injection, powder, for solutionIntramuscular; Parenteral0.9 MG
Powder, for solutionIntramuscular0.9 mg
Injection, powder, for solutionIntramuscular1.1 mg
Injection, solutionIntramuscular0.9 mg/1.08ml
Injection, powder, lyophilized, for solutionIntramuscular1.1 mg
Prices
Unit descriptionCostUnit
Thyrogen 1.1 mg vial1196.4USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)Region
US5840566No1998-11-242015-11-24US flag
Additional Data Available
  • Filed On
    Filed On
    Available for Purchase

    The date on which a patent was filed with the relevant government.

    Learn more

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)55 °CNot Available
hydrophobicity-0.330Not Available
isoelectric point7.50Not Available

Targets

Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Agonist
General Function
Thyroid-stimulating hormone receptor activity
Specific Function
Receptor for thyrothropin. Plays a central role in controlling thyroid cell metabolism. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Also acts as a rece...
Gene Name
TSHR
Uniprot ID
P16473
Uniprot Name
Thyrotropin receptor
Molecular Weight
86828.965 Da
References
  1. Szkudlinski MW: Recombinant human thyrotropins of the twenty-first century. Expert Opin Pharmacother. 2004 Dec;5(12):2435-40. [PubMed:15571461]
  2. Conway GS: Clinical manifestations of genetic defects affecting gonadotrophins and their receptors. Clin Endocrinol (Oxf). 1996 Dec;45(6):657-63. [PubMed:9039330]
  3. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]

Drug created on June 13, 2005 07:24 / Updated on November 25, 2020 08:53

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Logo pink
Stay in the know!
As part of our commitment to providing the most up-to-date drug information, we will be releasing #DrugBankUpdates with our newly added curated drug pages.
#DrugBankUpdates