Identification

Summary

Streptokinase is a purified fibrinolytic bacterial protein used to breakdown thrombosis in myocardial infarction, pulmonary embolism, and venous thromboembolism.

Generic Name
Streptokinase
DrugBank Accession Number
DB00086
Background

Streptokinase, is a sterile, purified preparation of a bacterial protein elaborated by group C (beta) -hemolytic streptococci.

Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Thrombolytic agents
Protein Structure
Db00086
Protein Chemical Formula
C2100H3278N566O669S4
Protein Average Weight
47286.7 Da
Sequences
>Streptokinase Sequence DB00086
MKNYLSFGMFALLFALTFGTVNSVQAIAGPEWLLDRPSVNNSQLVVSVAGTVEGTNQDIS
LKFFEIDLTSRPAHGGKTEQGLSPKSKPFATDSGAMSHKLEKADLLKAIQEQLIANVHSN
DDYFEVIDFASDATITDRNGKVYFADKDGSVTLPTQPVQEFLLSGHVRVRPYKEKPIQNQ
AKSVDVEYTVQFTPLNPDDDFRPGLKDTKLLKTLAIGDTITSQELLAQAQSILNKNHPGY
TIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKY
YVLKKGEKPYDPFDRSHLKLFTIKYVDVDTNELLKSEQLLTASERNLDFRDLYDPRDKAK
LLYNNLDAFGIMDYTLTGKVEDNHDDTNRIITVYMGKRPEGENASYHLAYDKDRYTEEER
EVYSYLRYTGTPIPDNPNDK
Download FASTA Format
Synonyms
  • Estreptoquinasa
  • Streptochinasi
  • Streptococcal fibrinolysin
  • Streptokinase
  • Streptokinasum

Pharmacology

Indication

For the treatment of acute evolving transmural myocardial infarction, pulmonary embolism, deep vein thrombosis, arterial thrombosis or emolism and occlusion of arteriovenous cannulae

Pharmacology
Reduce drug development failure rates
Build, train, & validate machine-learning models
with evidence-based and structured datasets.
See how
Build, train, & validate predictive machine-learning models with structured datasets.
See how
Associated Conditions
Contraindications & Blackbox Warnings
Contraindications
Avoid life-threatening adverse drug events
Improve clinical decision support with information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.
Learn more
Avoid life-threatening adverse drug events & improve clinical decision support.
Learn more
Pharmacodynamics

Streptokinase creates an active complex which promotes the cleavage of the Arg/Val bond in plasminogen to form the proteolytic enzyme plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. This helps eliminate blood clots or arterial blockages that cause myocardial infarction.

Mechanism of action

Plasminogen is an inactive molecule that becomes activated to plasmin when the Arg/Val bond is cleaved. Plasmin breaks down fibrin clots created by the blood clotting cascade. Streptokinase forms a highly specific 1:1 enzymatic complex with plasminogen which converts inactive plasminogen molecules into active plasmin. Plasmin degrades fibrin clots as well as fibrinogen and other plasma proteins. This in turn leads to the degradation of blood clots.

TargetActionsOrganism
APlasminogen
activator
Humans
UProteinase-activated receptor 1
activator
Humans
Absorption

Not Available

Volume of distribution

Not Available

Protein binding

Not Available

Metabolism
Not Available
Route of elimination

Not Available

Half-life

Not Available

Clearance

Not Available

Adverse Effects
Adverseeffects
Improve decision support & research outcomes
With structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates.
Learn more
Improve decision support & research outcomes with our structured adverse effects data.
Learn more
Toxicity

Not Available

Pathways
PathwayCategory
Streptokinase Action PathwayDrug action
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
AbciximabThe risk or severity of bleeding can be increased when Abciximab is combined with Streptokinase.
AcebutololThe risk or severity of adverse effects can be increased when Streptokinase is combined with Acebutolol.
AceclofenacThe risk or severity of bleeding and hemorrhage can be increased when Aceclofenac is combined with Streptokinase.
AcemetacinThe risk or severity of bleeding and hemorrhage can be increased when Streptokinase is combined with Acemetacin.
AcenocoumarolThe risk or severity of bleeding can be increased when Streptokinase is combined with Acenocoumarol.
Acetylsalicylic acidAcetylsalicylic acid may increase the anticoagulant activities of Streptokinase.
Albutrepenonacog alfaThe therapeutic efficacy of Albutrepenonacog alfa can be decreased when used in combination with Streptokinase.
AlclofenacThe risk or severity of bleeding and hemorrhage can be increased when Alclofenac is combined with Streptokinase.
AldesleukinThe risk or severity of adverse effects can be increased when Aldesleukin is combined with Streptokinase.
AlemtuzumabThe risk or severity of bleeding can be increased when Streptokinase is combined with Alemtuzumab.
Interactions
Identify potential medication risks
Easily compare up to 40 drugs with our drug interaction checker.
Get severity rating, description, and management advice.
Learn more
Food Interactions
  • Avoid herbs and supplements with anticoagulant/antiplatelet activity. Examples include garlic, ginger, bilberry, danshen, piracetam, and ginkgo biloba.

Products

Products2
Drug product information from 10+ global regions
Our datasets provide approved product information including:
dosage, form, labeller, route of administration, and marketing period.
Access now
Access drug product information from over 10 global regions.
Access now
Brand Name Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing EndRegionImage
Kabikinase - Pws 1500000units/vialPowder, for solution1500000 unit / vialIntracoronary; IntravenousPharmacia & Upjohn Inc1995-12-312001-07-30Canada flag
Kabikinase - Pws 250000 Unit/vialPowder, for solution250000 unit / vialIntracoronary; IntravenousPharmacia & Upjohn Inc1995-12-311999-08-12Canada flag
Kabikinase - Pws 750000units/vialPowder, for solution750000 unit / vialIntracoronary; IntravenousPharmacia & Upjohn Inc1995-12-312001-07-30Canada flag
StreptasePowder, for solution1500000 unit / vialIntracoronary; IntravenousCsl Behring1994-12-312012-02-22Canada flag
StreptasePowder, for solution750000 unit / vialIntracoronary; IntravenousCsl Behring1994-12-312012-02-22Canada flag
StreptasePowder, for solution250000 unit / vialIntracoronary; IntravenousCsl Behring1994-12-312012-02-22Canada flag
Streptase Inj 1500000 Unit/vialPowder, for solution1500000 unit / vialIntravenousHoechst Canada Inc.1991-12-311996-08-29Canada flag
Streptase Inj 250000unit/vialPowder, for solution250000 unit / vialIntravenousHoechst Canada Inc.1981-12-311996-08-29Canada flag
Streptase Inj 750000unit/vialPowder, for solution750000 unit / vialIntravenousHoechst Canada Inc.1981-12-311996-08-29Canada flag

Categories

ATC Codes
B01AD01 — StreptokinaseB06AA55 — Streptokinase, combinations
Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available
Affected organisms
  • Humans and other mammals

Chemical Identifiers

UNII
8X1OXL3SNU
CAS number
9002-01-1

References

Synthesis Reference

Lawrence Isaac Galler, "Streptokinase derivatives with high affinity for activated platelets and methods of their production and use in thrombolytic therapy." U.S. Patent US6087332, issued July, 1997.

US6087332
General References
Not Available
UniProt
P00779
Genbank
K02986
PubChem Substance
46505625
RxNav
10106
ChEMBL
CHEMBL2108147
Therapeutic Targets Database
DAP001198
PharmGKB
PA164754919
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Streptokinase

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
4CompletedTreatmentAcute Coronary Syndrome (ACS) / Acute Myocardial Infarction (AMI) / Reperfusion Injury1
4CompletedTreatmentAcute Myocardial Infarction (AMI)1
4CompletedTreatmentPulmonary Embolism / Pulmonary Thromboembolism1
4RecruitingTreatmentAcute Tracheobronchitis / Acute Upper Respiratory Infections1
4Unknown StatusTreatmentPleural Effusions1
3CompletedTreatmentAcute Myocardial Infarction (AMI)1
3CompletedTreatmentCardiovascular Disease (CVD) / Coronary Heart Disease (CHD) / Myocardial Infarction / Myocardial Ischemia2
3CompletedTreatmentMyocardial Infarction1
3CompletedTreatmentProsthetic Valve Thrombosis1
3CompletedTreatmentRespiratory Distress Syndrome, Acute (ARDS) / Severe Acute Respiratory Syndrome (SARS)1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
  • Pfizer Inc.
Dosage Forms
FormRouteStrength
Injection, powder, for solutionIntravenous1500 IU
Injection, powder, for solutionIntravenous750 IU
Injection, powder, lyophilized, for solutionIntravenous150000 IU
Injection, powder, lyophilized, for solutionParenteral100000 IU
Injection, powder, lyophilized, for solutionIntravenous250000 IU
Injection, powder, for solutionIntravenous
Injection, powder, lyophilized, for solutionParenteral1500000 IU
Injection, powder, lyophilized, for solutionParenteral250000 IU
Injection, powder, lyophilized, for solutionParenteral750000 IU
Powder, for solutionIntracoronary; Intravenous1500000 unit / vial
Powder, for solutionIntracoronary; Intravenous250000 unit / vial
Powder, for solutionIntracoronary; Intravenous750000 unit / vial
Powder, for solutionIntravenous1500000 unit / vial
Powder, for solutionIntravenous250000 unit / vial
Powder, for solutionIntravenous750000 unit / vial
Prices
Not Available
Patents
Not Available

Properties

State
Liquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.728Not Available
isoelectric point5.12Not Available

Targets

Drugtargets2
Build, predict & validate machine-learning models
Use our structured and evidence-based datasets to unlock new
insights and accelerate drug research.
Learn more
Use our structured and evidence-based datasets to unlock new insights and accelerate drug research.
Learn more
Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Activator
General Function
Serine-type peptidase activity
Specific Function
Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. In...
Gene Name
PLG
Uniprot ID
P00747
Uniprot Name
Plasminogen
Molecular Weight
90568.415 Da
References
  1. Caballero AR, Lottenberg R, Johnston KH: Cloning, expression, sequence analysis, and characterization of streptokinases secreted by porcine and equine isolates of Streptococcus equisimilis. Infect Immun. 1999 Dec;67(12):6478-86. [Article]
  2. Alessi MC, Juhan-Vague I: [Thrombolytics and their use]. Rev Prat. 1999 Oct 1;49(15):1654-8. [Article]
  3. Chaudhary A, Vasudha S, Rajagopal K, Komath SS, Garg N, Yadav M, Mande SC, Sahni G: Function of the central domain of streptokinase in substrate plasminogen docking and processing revealed by site-directed mutagenesis. Protein Sci. 1999 Dec;8(12):2791-805. [Article]
  4. Parry MA, Zhang XC, Bode I: Molecular mechanisms of plasminogen activation: bacterial cofactors provide clues. Trends Biochem Sci. 2000 Feb;25(2):53-9. [Article]
  5. Korol'chuk VI, Makohonenko IeM, Sederkhol'm-Vil'iams SA: [Plasminogen binding with decapeptide and polypeptide fragments of streptokinase]. Ukr Biokhim Zh (1999). 1999 Sep-Oct;71(5):51-8. [Article]
  6. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [Article]
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
Actions
Activator
General Function
Thrombin receptor activity
Specific Function
High affinity receptor for activated thrombin coupled to G proteins that stimulate phosphoinositide hydrolysis. May play a role in platelets activation and in vascular development.
Gene Name
F2R
Uniprot ID
P25116
Uniprot Name
Proteinase-activated receptor 1
Molecular Weight
47439.83 Da
References
  1. McRedmond JP, Harriott P, Walker B, Fitzgerald DJ: Streptokinase-induced platelet activation involves antistreptokinase antibodies and cleavage of protease-activated receptor-1. Blood. 2000 Feb 15;95(4):1301-8. [Article]
  2. Kahn ML, Nakanishi-Matsui M, Shapiro MJ, Ishihara H, Coughlin SR: Protease-activated receptors 1 and 4 mediate activation of human platelets by thrombin. J Clin Invest. 1999 Mar;103(6):879-87. [Article]

Enzymes

Kind
Protein
Organism
Humans
Pharmacological action
Unknown
Actions
Inducer
General Function
Phospholipase a2 activity
Specific Function
Selectively hydrolyzes arachidonyl phospholipids in the sn-2 position releasing arachidonic acid. Together with its lysophospholipid activity, it is implicated in the initiation of the inflammatory...
Gene Name
PLA2G4A
Uniprot ID
P47712
Uniprot Name
Cytosolic phospholipase A2
Molecular Weight
85238.2 Da
References
  1. Kawaguchi H, Iizuka K, Sano H, Yasuda H: Effect of streptokinase on prostacyclin synthesis and phospholipase activity in cultured pulmonary artery endothelial cells. Biochim Biophys Acta. 1990 Dec 10;1055(3):223-9. [Article]

Drug created at June 13, 2005 13:24 / Updated at November 02, 2021 09:20