5-hydroxytryptamine receptor 1D
Details
- Name
- 5-hydroxytryptamine receptor 1D
- Synonyms
- 5-HT-1D
- 5-HT-1D-alpha
- HTR1DA
- HTRL
- Serotonin 1D alpha receptor
- Serotonin receptor 1D
- Gene Name
- HTR1D
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0010458|5-hydroxytryptamine receptor 1D MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVL TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDIT CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAK AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFT TAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAARERKAT KILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFN EEFRQAFQKIVPFRKAS
- Number of residues
- 377
- Molecular Weight
- 41906.38
- Theoretical pI
- 8.85
- GO Classification
- Functionsserotonin binding / serotonin receptor activityProcessesadenylate cyclase-inhibiting G-protein coupled receptor signaling pathway / G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger / intestine smooth muscle contraction / regulation of behavior / regulation of locomotion / response to toxic substance / serotonin receptor signaling pathway / synaptic transmission / vasoconstrictionComponentsintegral component of plasma membrane / plasma membrane
- General Function
- Serotonin receptor activity
- Specific Function
- G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for ergot alkaloid derivatives, various anxiolytic and antidepressant drugs and other psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity. Regulates the release of 5-hydroxytryptamine in the brain, and thereby affects neural activity. May also play a role in regulating the release of other neurotransmitters. May play a role in vasoconstriction.
- Pfam Domain Function
- 7tm_1 (PF00001)
- Transmembrane Regions
- 39-64 76-98 113-134 155-176 195-217 303-326 336-360
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0010459|5-hydroxytryptamine receptor 1D (HTR1D) ATGTCCCCACTGAACCAGTCAGCAGAAGGCCTTCCCCAGGAGGCCTCCAACAGATCCCTG AATGCCACAGAAACCTCAGAGGCTTGGGATCCCAGGACCCTCCAGGCGCTCAAGATCTCC CTTGCCGTGGTCCTTTCCGTCATCACACTGGCCACAGTCCTCTCCAATGCCTTTGTACTC ACCACCATCTTACTCACCAGGAAGCTCCACACCCCTGCCAACTACCTGATTGGCTCCCTG GCCACCACCGACCTCTTGGTTTCCATCTTGGTAATGCCCATCAGCATCGCCTATACCATC ACCCACACCTGGAACTTTGGCCAAATCTTGTGTGACATCTGGCTGTCCTCTGACATCACG TGCTGCACAGCCTCCATCCTGCATCTCTGTGTCATTGCTCTGGACAGGTACTGGGCAATC ACAGATGCCCTGGAATACAGTAAACGCAGGACGGCTGGCCACGCGGCCACCATGATCGCC ATTGTCTGGGCCATCTCCATCTGCATCTCCATCCCCCCGCTCTTCTGGCGGCAGGCCAAG GCCCAGGAGGAGATGTCGGACTGTCTGGTGAACACCTCTCAGATCTCCTACACCATCTAC TCCACCTGTGGGGCCTTCTACATTCCCTCGGTGTTGCTCATCATCCTATATGGCCGGATC TACCGGGCTGCCCGGAACCGCATCCTGAATCCACCCTCACTCTATGGGAAGCGCTTCACC ACGGCCCACCTCATCACAGGCTCTGCCGGGTCCTCGCTCTGCTCGCTCAACTCCAGCCTC CATGAGGGGCACTCGCACTCGGCTGGCTCCCCTCTCTTTTTCAACCACGTGAAAATCAAG CTTGCTGACAGTGCCCTGGAACGCAAGAGGATTTCTGCTGCTCGAGAAAGGAAAGCCACT AAAATCCTGGGCATCATTCTGGGGGCCTTTATCATCTGCTGGCTGCCCTTCTTCGTGGTG TCTCTGGTCCTCCCCATCTGCCGGGACTCCTGCTGGATCCACCCGGCGCTCTTTGACTTC TTCACCTGGCTAGGCTATTTAAACTCCCTCATCAATCCAATAATCTACACTGTGTTTAAT GAAGAGTTTCGGCAAGCTTTTCAGAAAATTGTCCCTTTCCGGAAGGCCTCCTAG
- Chromosome Location
- 1
- Locus
- 1p36.3-p34.3
- External Identifiers
Resource Link UniProtKB ID P28221 UniProtKB Entry Name 5HT1D_HUMAN GenBank Protein ID 177772 GenBank Gene ID M89955 GenAtlas ID HTR1D HGNC ID HGNC:5289 - General References
- Hamblin MW, Metcalf MA: Primary structure and functional characterization of a human 5-HT1D-type serotonin receptor. Mol Pharmacol. 1991 Aug;40(2):143-8. [PubMed:1652050]
- Weinshank RL, Zgombick JM, Macchi MJ, Branchek TA, Hartig PR: Human serotonin 1D receptor is encoded by a subfamily of two distinct genes: 5-HT1D alpha and 5-HT1D beta. Proc Natl Acad Sci U S A. 1992 Apr 15;89(8):3630-4. [PubMed:1565658]
- Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
- Gonzalez-Heydrich J, Peroutka SJ: Postsynaptic localization of 5-HT1D receptor binding sites in human caudate. Exp Neurol. 1991 Jul;113(1):28-30. [PubMed:1828434]
- Xie Z, Lee SP, O'Dowd BF, George SR: Serotonin 5-HT1B and 5-HT1D receptors form homodimers when expressed alone and heterodimers when co-expressed. FEBS Lett. 1999 Jul 30;456(1):63-7. [PubMed:10452531]
- Nichols DE, Nichols CD: Serotonin receptors. Chem Rev. 2008 May;108(5):1614-41. doi: 10.1021/cr078224o. Epub 2008 May 14. [PubMed:18476671]
- Pytliak M, Vargova V, Mechirova V, Felsoci M: Serotonin receptors - from molecular biology to clinical applications. Physiol Res. 2011;60(1):15-25. Epub 2010 Oct 15. [PubMed:20945968]
- Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES: Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. 1999 Jul;22(3):231-8. [PubMed:10391209]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB00216 Eletriptan approved, investigational yes agonist Details DB00315 Zolmitriptan approved, investigational yes agonist Details DB00320 Dihydroergotamine approved, investigational yes agonist Details DB00669 Sumatriptan approved, investigational yes agonist Details DB00918 Almotriptan approved, investigational unknown agonist Details DB00952 Naratriptan approved, investigational yes agonist Details DB00953 Rizatriptan approved yes agonist Details DB00998 Frovatriptan approved, investigational yes agonist Details DB00246 Ziprasidone approved yes antagonist Details DB00696 Ergotamine approved yes agonist Details DB06096 NXN-188 investigational unknown Details DB01186 Pergolide approved, investigational, vet_approved, withdrawn unknown agonist Details DB01200 Bromocriptine approved, investigational unknown agonist Details DB00589 Lisuride approved, investigational unknown agonist Details DB00248 Cabergoline approved unknown agonist Details DB00714 Apomorphine approved, investigational unknown agonist Details DB01267 Paliperidone approved unknown antagonist Details DB01224 Quetiapine approved unknown ligand Details DB00363 Clozapine approved unknown antagonist Details DB01238 Aripiprazole approved, investigational unknown antagonistligand Details DB01392 Yohimbine approved, investigational, vet_approved unknown partial agonist Details DB00408 Loxapine approved unknown binder Details DB00726 Trimipramine approved unknown binder Details DB00321 Amitriptyline approved unknown binder Details DB06153 Pizotifen approved unknown antagonist Details DB04948 Lofexidine approved, investigational no agonist Details DB14185 Aripiprazole lauroxil approved, investigational unknown Details DB00734 Risperidone approved, investigational unknown antagonist Details DB00574 Fenfluramine approved, illicit, investigational, withdrawn yes agonist Details DB00935 Oxymetazoline approved, investigational unknown agonist Details DB13025 Tiapride investigational yes antagonist Details DB09304 Setiptiline experimental unknown antagonist Details DB13345 Dihydroergocristine approved, experimental yes antagonist Details DB01049 Ergoloid mesylate approved yes antagonistagonist Details DB11273 Dihydroergocornine approved yes antagonistagonist Details DB12141 Gilteritinib approved, investigational no inhibitor Details DB00715 Paroxetine approved, investigational unknown Details DB01239 Chlorprothixene approved, experimental, investigational, withdrawn yes inhibitor Details DB01221 Ketamine approved, vet_approved unknown antagonist Details DB00334 Olanzapine approved, investigational unknown inhibitor Details