Penicillin-binding protein 3
Details
- Name
- Penicillin-binding protein 3
- Synonyms
- Putative D-alanyl-D-alanine carboxypeptidase
- Gene Name
- pbp3
- Organism
- Streptococcus pneumoniae
- Amino acid sequence
>lcl|BSEQ0017497|Penicillin-binding protein 3 MKKIFLTLLTVSLLGGASTAVAQDFTIAAKHAIAVEANTGKILYEKDATQPVEIASITKL ITVYLVYEALENGSITLSTPVDISDYPYQLTTNSEASNIPMEARNYTVEELLEATLVSSA NSAAIALAEKIAGSEKDFVDMMRAKLLEWGIQDATVVNTTGLNNETLGDNIYPGSKKDEE NKLSAYDVAIVARNLIKKYPQVLEITKKPSSTFAGMTITSTNYMLEGMPAYRGGFDGLKT GTTDKAGESFVGTTVEKGMRVITVVLNADHQDNNPYARFTATSSLMDYISSTFTLRKIVQ QGDAYQDSKTPVQDGKEDTVTAVAPEDIYLIERVGNQSSQSVQFTPDSKAIPAPLEAGTV VGHLTYEDKDLIGQGYITTERPSFEMVADKKIEKAFFLKVWWNQFVRFVNEKL
- Number of residues
- 413
- Molecular Weight
- 45209.84
- Theoretical pI
- Not Available
- GO Classification
- Functionsserine-type D-Ala-D-Ala carboxypeptidase activity
- General Function
- Serine-type d-ala-d-ala carboxypeptidase activity
- Specific Function
- Not Available
- Pfam Domain Function
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q75Y35 UniProtKB Entry Name Q75Y35_STREE - General References
- Sanbongi Y, Ida T, Ishikawa M, Osaki Y, Kataoka H, Suzuki T, Kondo K, Ohsawa F, Yonezawa M: Complete sequences of six penicillin-binding protein genes from 40 Streptococcus pneumoniae clinical isolates collected in Japan. Antimicrob Agents Chemother. 2004 Jun;48(6):2244-50. [Article]
- Kosowska-Shick K, McGhee P, Appelbaum PC: Binding of faropenem and other beta-lactam agents to penicillin-binding proteins of pneumococci with various beta-lactam susceptibilities. Antimicrob Agents Chemother. 2009 May;53(5):2176-80. doi: 10.1128/AAC.01566-08. Epub 2009 Feb 23. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB01140 Cefadroxil approved, vet_approved, withdrawn yes inhibitor Details DB00319 Piperacillin approved yes inhibitor Details DB00607 Nafcillin approved, investigational yes inhibitor Details DB00415 Ampicillin approved, vet_approved yes inhibitor Details DB00485 Dicloxacillin approved, investigational, vet_approved yes inhibitor Details DB01163 Amdinocillin investigational, withdrawn yes inhibitor Details DB01603 Meticillin approved, investigational yes inhibitor Details DB00456 Cefalotin approved, investigational, vet_approved yes inhibitor Details DB00713 Oxacillin approved, investigational yes inhibitor Details DB01331 Cefoxitin approved yes inhibitor Details DB00567 Cephalexin approved, investigational, vet_approved yes inhibitor Details DB03313 Cephalosporin C experimental yes inhibitor Details DB00948 Mezlocillin approved, investigational yes inhibitor Details DB00833 Cefaclor approved yes inhibitor Details DB00447 Loracarbef approved, investigational, withdrawn yes inhibitor Details DB08795 Azidocillin experimental yes inhibitor Details DB00739 Hetacillin approved, vet_approved, withdrawn yes inhibitor Details DB01330 Cefotetan approved yes inhibitor Details DB01000 Cyclacillin approved yes inhibitor Details