Heads up!
We’ve moved some things around. Take a quick tour to learn what has changed.
Take the tour
No thanks!
Interferon beta-1a
Identification
- Name
- Interferon beta-1a
- Accession Number
- DB00060
- Description
Human interferon beta (166 residues), glycosylated, MW=22.5kD. It is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence is identical to that of natural human interferon beta.
- Type
- Biotech
- Groups
- Approved, Investigational
- Biologic Classification
- Protein Based Therapies
Interferons - Protein Structure
- Protein Chemical Formula
- C908H1408N246O252S7
- Protein Average Weight
- 20027.0 Da
- Sequences
>DB00060 sequence MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIY EMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSL HLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Download FASTA Format- Synonyms
- Interferon beta 1-a
- Interferon beta 1a
- Interferon beta-1a (recombinant human)
- Interferon beta-1a,recombinant
- Interferon-beta-1a
Pharmacology
- Indication
For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
- Associated Conditions
- Contraindications & Blackbox Warnings
Learn about our commercial Contraindications & Blackbox Warnings data.
Learn More- Pharmacodynamics
Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
- Mechanism of action
Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Target Actions Organism AInterferon alpha/beta receptor 1 agonistHumans AInterferon alpha/beta receptor 2 Not Available Humans - Absorption
- Not Available
- Volume of distribution
- Not Available
- Protein binding
- Not Available
- Metabolism
- Not Available
- Route of elimination
- Not Available
- Half-life
10 hrs
- Clearance
- 33-55 L/hour [Healthy SC injection of 60 mcg]
- Adverse Effects
Learn about our commercial Adverse Effects data.
Learn More- Toxicity
- Not Available
- Affected organisms
- Not Available
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRs
- Not Available
Interactions
- Drug Interactions
- This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
Drug Interaction Unlock Additional DataAcenocoumarol The metabolism of Acenocoumarol can be decreased when combined with Interferon beta-1a. Acetaminophen The metabolism of Acetaminophen can be decreased when combined with Interferon beta-1a. Acyclovir The metabolism of Acyclovir can be decreased when combined with Interferon beta-1a. Adenovirus type 7 vaccine live The therapeutic efficacy of Adenovirus type 7 vaccine live can be decreased when used in combination with Interferon beta-1a. Agomelatine The metabolism of Agomelatine can be decreased when combined with Interferon beta-1a. Albendazole The metabolism of Albendazole can be decreased when combined with Interferon beta-1a. Alosetron The metabolism of Alosetron can be decreased when combined with Interferon beta-1a. Aminophenazone The metabolism of Aminophenazone can be decreased when combined with Interferon beta-1a. Aminophylline The metabolism of Aminophylline can be decreased when combined with Interferon beta-1a. Amitriptyline The metabolism of Amitriptyline can be decreased when combined with Interferon beta-1a. Additional Data Available- Extended DescriptionExtended Description
Extended description of the mechanism of action and particular properties of each drug interaction.
Learn more - Severity
- Evidence Level
- ActionAction
An effect category for each drug interaction. Know how this interaction affects the subject drug.
Learn more
- Food Interactions
- Not Available
Products
- International/Other Brands
- Betaferon (Bayer) / Blastoferon (Sidus) / Uribeta (Probiomed)
- Brand Name Prescription Products
Name Dosage Strength Route Labeller Marketing Start Marketing End Region Image Unlock Additional DataAvonex Injection, powder, lyophilized, for solution 30 ug/1mL Intramuscular Biogen Inc. 1996-05-17 2016-07-31 US 
Avonex Powder, for solution 60 mcg Intramuscular Biogen Not applicable Not applicable Canada 
Avonex Injection, solution 30 ug/0.5mL Intramuscular Biogen Inc. 2003-05-23 2016-08-31 US Avonex Solution 30 mcg Intramuscular Biogen 2005-12-02 Not applicable Canada Avonex Pen Injection, solution 30 ug/0.5mL Intramuscular Biogen Inc. 2003-05-23 2016-06-30 US Rebif Injection, solution 44 ug/0.5mL Subcutaneous EMD Serono, Inc. 2002-03-07 Not applicable US Rebif Solution 44 mcg Subcutaneous Emd Serono, A Division Of Emd Inc., Canada 1998-02-24 Not applicable Canada Rebif Solution 132 mcg Subcutaneous Emd Serono, A Division Of Emd Inc., Canada Not applicable Not applicable Canada Rebif Solution 132 mcg Subcutaneous Emd Serono, A Division Of Emd Inc., Canada 2009-05-14 Not applicable Canada Rebif Injection, solution 22 ug/0.5mL Subcutaneous EMD Serono, Inc. 2002-03-07 Not applicable US Additional Data Available- Application NumberApplication Number
A unique ID assigned by the FDA when a product is submitted for approval by the labeller.
Learn more - Product CodeProduct Code
A governmentally-recognized ID which uniquely identifies the product within its regulatory market.
Learn more
- Mixture Products
Name Ingredients Dosage Route Labeller Marketing Start Marketing End Region Image Avonex Interferon beta-1a (30 mcg) + Water (1.1 ml) Powder, for solution Intramuscular Biogen 1998-06-19 2010-10-30 Canada Avonex Interferon beta-1a (30 ug/0.5mL) + Isopropyl alcohol (0.70 mL/1mL) Kit Intramuscular Biogen Inc. 2014-08-29 Not applicable US Avonex Interferon beta-1a (30 ug/0.5mL) + Isopropyl alcohol (0.70 mL/1mL) Kit Intramuscular Biogen Inc. 2014-08-29 Not applicable US Avonex Interferon beta-1a (30 ug/1mL) + Isopropyl alcohol (0.70 mL/1mL) Kit Intramuscular Biogen Inc. 2014-08-29 Not applicable US Rebif Interferon beta-1a (8.8 ug/0.2mL) + Interferon beta-1a (22 ug/0.5mL) Kit Subcutaneous EMD Serono, Inc. 2004-12-17 Not applicable US Rebif Interferon beta-1a (8.8 mcg) + Interferon beta-1a (22 mcg) Kit; Liquid; Powder, for solution Subcutaneous Emd Serono, A Division Of Emd Inc., Canada 2006-06-19 2013-08-09 Canada Rebif Interferon beta-1a (8.8 ug/0.2mL) + Interferon beta-1a (22 ug/0.5mL) Kit Subcutaneous EMD Serono, Inc. 2004-12-17 Not applicable US Rebif Interferon beta-1a (8.8 mcg) + Interferon beta-1a (22 mcg) Kit; Liquid; Powder, for solution Subcutaneous Emd Serono, A Division Of Emd Inc., Canada 2006-06-19 2013-08-09 Canada Rebif Interferon beta-1a (11 mcg) + Sodium chloride (2 ml) Kit; Liquid; Powder Intralesional; Subcutaneous Emd Serono, A Division Of Emd Inc., Canada 1998-04-03 2011-05-09 Canada Rebif Rebidose Interferon beta-1a (8.8 ug/0.2mL) + Interferon beta-1a (22 ug/0.5mL) Kit Subcutaneous EMD Serono, Inc. 2012-12-21 Not applicable US
Categories
- ATC Codes
- L03AB07 — Interferon beta-1a
- Drug Categories
- Adjuvants, Immunologic
- Amino Acids, Peptides, and Proteins
- Anti-Infective Agents
- Antineoplastic and Immunomodulating Agents
- Antiviral Agents
- Biological Factors
- Cytochrome P-450 CYP1A2 Inhibitors
- Cytochrome P-450 CYP1A2 Inhibitors (strength unknown)
- Cytochrome P-450 Enzyme Inhibitors
- Cytokines
- Immunologic Factors
- Immunomodulatory Agents
- Intercellular Signaling Peptides and Proteins
- Interferon Type I
- Interferon-beta
- Interferons
- Peptides
- Proteins
- Recombinant Human Interferon beta
- Chemical TaxonomyProvided by Classyfire
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
Chemical Identifiers
- UNII
- XRO4566Q4R
- CAS number
- 145258-61-3
References
- Synthesis Reference
Heinz-Jurgen Friesen, Sidney Pestka, "Preparation of homogeneous human fibroblast interferon." U.S. Patent US4289689, issued December, 1968.
US4289689- General References
- Not Available
- External Links
- UniProt
- P01574
- Genbank
- V00534
- PubChem Substance
- 46504899
- 75917
- ChEMBL
- CHEMBL1201562
- Therapeutic Targets Database
- DAP001282
- PharmGKB
- PA450037
- RxList
- RxList Drug Page
- Drugs.com
- Drugs.com Drug Page
- Wikipedia
- Interferon_beta-1a
- AHFS Codes
- 92:20.00 — Immunomodulatory Agents
- FDA label
- Download (63 KB)
Clinical Trials
- Clinical Trials
Phase Status Purpose Conditions Count 4 Active Not Recruiting Treatment Relapsing Remitting Multiple Sclerosis (RRMS) 1 4 Completed Not Available Disseminated Sclerosis 2 4 Completed Not Available Relapsing Remitting Multiple Sclerosis (RRMS) 1 4 Completed Basic Science Disseminated Sclerosis 1 4 Completed Other Disseminated Sclerosis 1 4 Completed Treatment Acute Brainstem/Cerebellar Syndrome / Disseminated Sclerosis / Optic Neuritis / Transverse Myelitis 1 4 Completed Treatment Clinically Isolated Syndrome (CIS) / Relapsing Multiple Sclerosis (RMS) 1 4 Completed Treatment Disseminated Sclerosis 5 4 Completed Treatment Relapsing Forms of Multiple Sclerosis 1 4 Completed Treatment Relapsing Remitting Multiple Sclerosis (RRMS) 15
Pharmacoeconomics
- Manufacturers
- Biogen Idec
- Packagers
- Biogen Idec Inc.
- EMD Canada Inc.
- Merck KGaA
- Merck Serono SPA
- Pierre Fabre
- Vetter Pharma Fertigung GmbH and Co. KG
- Dosage Forms
Form Route Strength Injection, powder, lyophilized, for solution Intramuscular 30 ug/1mL Kit Intramuscular Powder, for solution Intramuscular Powder, for solution Intramuscular 60 mcg Injection Intramuscular 30 mcg/0.5ml Injection, solution Intramuscular 30 ug/0.5mL Solution Intramuscular 30 mcg Solution Subcutaneous 22 mcg Injection, solution Subcutaneous 22 ug/0.5mL Injection, solution Subcutaneous 44 ug/0.5mL Kit Subcutaneous Kit; liquid; powder Intralesional; Subcutaneous Kit; liquid; powder, for solution Subcutaneous Solution Subcutaneous 132 mcg Solution Subcutaneous 44 mcg Solution Subcutaneous 66 mcg Solution Subcutaneous 8.8 mcg Injection, solution Subcutaneous 132 mcg/1.5ml Injection, solution Subcutaneous 22 mcg/0.5ml Injection, solution Subcutaneous 44 mcg/0.5ml Injection, solution Subcutaneous 66 mcg/1.5ml - Prices
Unit description Cost Unit Avonex 4 30 mcg/vial Kit 1 Box = 4 Vials ( 0.5ml Per Vial) 3252.29USD box Avonex Prefilled (1 Box = 1 Kit = Four 30 mcg/0.5ml Syringes) Box 3252.29USD box Avonex admin pack 30 mcg vial 781.8USD vial Rebif 22 mcg/0.5 ml syringe 247.79USD syringe Rebif 44 mcg/0.5 ml syringe 247.79USD syringe DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.- Patents
Patent Number Pediatric Extension Approved Expires (estimated) Region Unlock Additional DataCA1341604 No 2010-05-04 2027-05-04 Canada Additional Data Available- Filed On
Properties
- State
- Liquid
- Experimental Properties
Property Value Source hydrophobicity -0.427 Not Available isoelectric point 8.93 Not Available
Targets
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- Actions
- Agonist
- General Function
- Type i interferon receptor activity
- Specific Function
- Associates with IFNAR2 to form the type I interferon receptor. Receptor for interferons alpha and beta. Binding to type I IFNs triggers tyrosine phosphorylation of a number of proteins including JA...
- Gene Name
- IFNAR1
- Uniprot ID
- P17181
- Uniprot Name
- Interferon alpha/beta receptor 1
- Molecular Weight
- 63524.81 Da
References
- Russell-Harde D, Wagner TC, Perez HD, Croze E: Formation of a uniquely stable type I interferon receptor complex by interferon beta is dependent upon particular interactions between interferon beta and its receptor and independent of tyrosine phosphorylation. Biochem Biophys Res Commun. 1999 Feb 16;255(2):539-44. [PubMed:10049744]
- van Koetsveld PM, Vitale G, de Herder WW, Feelders RA, van der Wansem K, Waaijers M, van Eijck CH, Speel EJ, Croze E, van der Lely AJ, Lamberts SW, Hofland LJ: Potent inhibitory effects of type I interferons on human adrenocortical carcinoma cell growth. J Clin Endocrinol Metab. 2006 Nov;91(11):4537-43. Epub 2006 Aug 15. [PubMed:16912135]
- Dupont SA, Goelz S, Goyal J, Green M: Mechanisms for regulation of cellular responsiveness to human IFN-beta1a. J Interferon Cytokine Res. 2002 Apr;22(4):491-501. [PubMed:12034032]
- Runkel L, De Dios C, Karpusas M, Baker D, Li Z, Zafari M, Betzenhauser M, Muldowney C, Miller S, Redlich PN, Grossberg SE, Whitty A, Hochman PS: Mapping of IFN-beta epitopes important for receptor binding and biologic activation: comparison of results achieved using antibody-based methods and alanine substitution mutagenesis. J Interferon Cytokine Res. 2001 Nov;21(11):931-41. [PubMed:11747625]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- General Function
- Type i interferon receptor activity
- Specific Function
- Associates with IFNAR1 to form the type I interferon receptor. Receptor for interferons alpha and beta. Involved in IFN-mediated STAT1, STAT2 and STAT3 activation. Isoform 1 and isoform 2 are direc...
- Gene Name
- IFNAR2
- Uniprot ID
- P48551
- Uniprot Name
- Interferon alpha/beta receptor 2
- Molecular Weight
- 57758.24 Da
References
- van Koetsveld PM, Vitale G, de Herder WW, Feelders RA, van der Wansem K, Waaijers M, van Eijck CH, Speel EJ, Croze E, van der Lely AJ, Lamberts SW, Hofland LJ: Potent inhibitory effects of type I interferons on human adrenocortical carcinoma cell growth. J Clin Endocrinol Metab. 2006 Nov;91(11):4537-43. Epub 2006 Aug 15. [PubMed:16912135]
- Runkel L, De Dios C, Karpusas M, Baker D, Li Z, Zafari M, Betzenhauser M, Muldowney C, Miller S, Redlich PN, Grossberg SE, Whitty A, Hochman PS: Mapping of IFN-beta epitopes important for receptor binding and biologic activation: comparison of results achieved using antibody-based methods and alanine substitution mutagenesis. J Interferon Cytokine Res. 2001 Nov;21(11):931-41. [PubMed:11747625]
Enzymes
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Unknown
- Actions
- Inhibitor
- General Function
- Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
- Specific Function
- Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally un...
- Gene Name
- CYP1A2
- Uniprot ID
- P05177
- Uniprot Name
- Cytochrome P450 1A2
- Molecular Weight
- 58293.76 Da
References
- Delaporte E, Renton KW: Cytochrome P4501A1 and cytochrome P4501A2 are downregulated at both transcriptional and post-transcriptional levels by conditions resulting in interferon-alpha/beta induction. Life Sci. 1997;60(10):787-96. doi: 10.1016/s0024-3205(97)00006-4. [PubMed:9064483]
Drug created on June 13, 2005 07:24 / Updated on September 22, 2020 02:11
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
![]({"CS-Molecular-Health-1.jpg":"/assets/ads/CS-Molecular-Health-1-19e76f023997d5ac198da2cb9976457f7b9ba733f0ea8a780fe21191c759e8fa.jpg","Drug-Dev-2.jpg":"/assets/ads/Drug-Dev-2-7c3039d93245f493c23278efbf759e4f933848a676262d579087d5cc516af179.jpg","Drug-Search-3.jpg":"/assets/ads/Drug-Search-3-7346c33d2133f62b46cbfbbe2b666e78f955c6847e242692c6081fec37c4d10d.jpg","PM-3.jpg":"/assets/ads/PM-3-13494ac4c996d71619127a11f685681418d4280832dec162c0b2c9c8bc2eda50.jpg","OD-Webinar-1.jpg":"/assets/ads/OD-Webinar-1-f9357f6d57fef5e411aa1c0439ef46c86d9151214434659d096eeed6407b799b.jpg","DDI-3.jpg":"/assets/ads/DDI-3-12808cf864d540ad43757b10b08fc52ae93e793b0c6e81345555187b2840ad09.jpg","EMR-2.jpg":"/assets/ads/EMR-2-adacf8de3f42cb06d6676d06fce611c29781db6ad30776cd18b72a7d8e69f0c8.jpg","Covid.jpg":"/assets/ads/Covid-eed8f17668b0308db62ce3c656f5e2f562376e9185ae08dda5ce6ed9ab0bbd1f.jpg","CS-Molecular-Health-2.jpg":"/assets/ads/CS-Molecular-Health-2-22f41f94b3f87e44a1dcaa8f6c03dc411ab69558efd4f3148ff9bb6adaa956dc.jpg","PM-5.jpg":"/assets/ads/PM-5-d0dc031e0fa0d0097d912eff07b7e80b27b867264dd5b055e379a57bfa2a8723.jpg","DDI-4.jpg":"/assets/ads/DDI-4-313b9c374b937fd78bb2ade652b9b030abb9e6cb90efd35833f793e384e8185b.jpg","Discover-1.jpg":"/assets/ads/Discover-1-b48ae6a3872eeb442f4c22a9a1d867428c83a917ec78a8c3ff4e02f84c5d4fef.jpg","Discover-2.jpg":"/assets/ads/Discover-2-6e7759998ee0fdc234cd84eea962f2480f0c7dafadabd785924918420decb102.jpg","Repurpose-1.jpg":"/assets/ads/Repurpose-1-265fbec40f0eac18d51d3ec4f558c10cb623d834ea75e0296259e458b72ee6d4.jpg","Repurpose-2.jpg":"/assets/ads/Repurpose-2-d12bd1d18b92d36eab60e71e6fd59acf04ef60a53783570e11eef397a0e0f4f5.jpg","PM-6.jpg":"/assets/ads/PM-6-3ae66e41f7ae1e851a0910be89141cf2533509b46df6379464efc885d5ee2f07.jpg","Drug-Search-4.jpg":"/assets/ads/Drug-Search-4-2a9102bd41f16e8c40c9d8044d1dcb6f206ff80107cc269aa83d02ea683bc829.jpg","DDI-5.jpg":"/assets/ads/DDI-5-fa1c287946f4044094c723161577cb5ac631f9cd1217446e510dc79ace6cb94e.jpg","TH-1.jpg":"/assets/ads/TH-1-55a9077bb39e8c38a68c67b555b8091d21a9d41b1c21c7daed3fe53e6f9f3c97.jpg","TH-2.jpg":"/assets/ads/TH-2-1d488747fa4af00ab970a48dba0b228b054d166aa22c1760a310e2b72dd22589.jpg","ThriveHealth-1.jpg":"/assets/ads/ThriveHealth-1-fe42678c71bf2ec7d508fde77efbe9f0aa868c5fa03bd39a7e1c97cefac0fa9d.jpg","ThriveHealth-2.jpg":"/assets/ads/ThriveHealth-2-32bb14bb00de8a1b2efc2a51ce37f490c01e76dac7b9c09b6b831c50640b6567.jpg","ThriveHealth-3.jpg":"/assets/ads/ThriveHealth-3-e184eae1745f8aa22525b294b761ee89f5a854a434d50e5d6d37c0b77f2cf523.jpg","ThriveHealth-4.jpg":"/assets/ads/ThriveHealth-4-218f710e6d20831711d0920e585b986217c38f38d9849b8dd32bb56f68d2eea9.jpg"})
Stay in the know!
As part of our commitment to providing the most up-to-date drug information, we will be releasing #DrugBankUpdates with our newly added curated drug pages.
#DrugBankUpdates