Identification
- Summary
Botulinum toxin type B is a purified form of botulinum toxin type B used to block acetylcholine release in the treatment of cervical dystonia and sialorrhea.
- Brand Names
- Myobloc
- Generic Name
- Botulinum toxin type B
- DrugBank Accession Number
- DB00042
- Background
Neurotoxin produced by fermentation of clostridium botulinum type B. The protein exists in noncovalent association with hemagglutinin and nonhemagglutinin proteins as a neurotoxin complex. The neurotoxin complex is recovered from the fermentation process and purified through a series of precipitation and chromatography steps.
- Type
- Biotech
- Groups
- Approved, Investigational
- Biologic Classification
- Protein Based Therapies
Other protein based therapies - Protein Structure
- Protein Chemical Formula
- Not Available
- Protein Average Weight
- 150804.0 Da
- Sequences
>Botulinum neurotoxin type B - Clostridium botulinum MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERYTFGYKPEDFN KSSGIFNRDVCEYYDPDYLNTNDKKNIFLQTMIKLFNRIKSKPLGEKLLEMIINGIPYLG DRRVPLEEFNTNIASVTVNKLISNPGEVERKKGIFANLIIFGPGPVLNENETIDIGIQNH FASREGFGGIMQMKFCPEYVSVFNNVQENKGASIFNRRGYFSDPALILMHELIHVLHGLY GIKVDDLPIVPNEKKFFMQSTDAIQAEELYTFGGQDPSIITPSTDKSIYDKVLQNFRGIV DRLNKVLVCISDPNININIYKNKFKDKYKFVEDSEGKYSIDVESFDKLYKSLMFGFTETN IAENYKIKTRASYFSDSLPPVKIKNLLDNEIYTIEEGFNISDKDMEKEYRGQNKAINKQA YEEISKEHLAVYKIQMCKSVKAPGICIDVDNEDLFFIADKNSFSDDLSKNERIEYNTQSN YIENDFPINELILDTDLISKIELPSENTESLTDFNVDVPVYEKQPAIKKIFTDENTIFQY LYSQTFPLDIRDISLTSSFDDALLFSNKVYSFFSMDYIKTANKVVEAGLFAGWVKQIVND FVIEANKSNTMDKIADISLIVPYIGLALNVGNETAKGNFENAFEIAGASILLEFIPELLI PVVGAFLLESYIDNKNKIIKTIDNALTKRNEKWSDMYGLIVAQWLSTVNTQFYTIKEGMY KALNYQAQALEEIIKYRYNIYSEKEKSNINIDFNDINSKLNEGINQAIDNINNFINGCSV SYLMKKMIPLAVEKLLDFDNTLKKNLLNYIDENKLYLIGSAEYEKSKVNKYLKTIMPFDL SIYTNDTILIEMFNKYNSEILNNIILNLRYKDNNLIDLSGYGAKVEVYDGVELNDKNQFK LTSSANSKIRVTQNQNIIFNSVFLDFSVSFWIRIPKYKNDGIQNYIHNEYTIINCMKNNS GWKISIRGNRIIWTLIDINGKTKSVFFEYNIREDISEYINRWFFVTITNNLNNAKIYING KLESNTDIKDIREVIANGEIIFKLDGDIDRTQFIWMKYFSIFNTELSQSNIEERYKIQSY SEYLKDFWGNPLMYNKEYYMFNAGNKNSYIKLKKDSPVGEILTRSKYNQNSKYINYRDLY IGEKFIIRRKSNSQSINDDIVRKEDYIYLDFFNLNQEWRVYTYKYFKKEEEKLFLAPISD SDEFYNTIQIKEYDEQPTYSCQLLFKKDEESTDEIGLIGIHRFYESGIVFEEYKDYFCIS KWYLKEVKRKPYNLKLGCNWQFIPKDEGWTE
Download FASTA Format- Synonyms
- Botulin B
- Botulinum antitoxin type B
- Botulinum B toxin
- Botulinum neurotoxin type B precursor
- Botulinum toxin type B
- BTX-B
- RimabotulinumtoxinB
- Toxina botulínica B
- External IDs
- AN-0772
- AN0772
Pharmacology
- Indication
For the treatment of patients with cervical dystonia to reduce the severity of abnormal head position and neck pain associated with cervical dystonia.
Reduce drug development failure ratesBuild, train, & validate machine-learning modelswith evidence-based and structured datasets.Build, train, & validate predictive machine-learning models with structured datasets.- Associated Conditions
- Contraindications & Blackbox Warnings
Avoid life-threatening adverse drug eventsImprove clinical decision support with information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.Avoid life-threatening adverse drug events & improve clinical decision support.- Pharmacodynamics
Botulinum Toxin Type B inhibits acetylcholine release at the neuromuscular junction via a three stage process: 1) Heavy Chain mediated neurospecific binding of the toxin, 2) internalization of the toxin by receptor-mediated endocytosis, and 3) ATP and pH dependent translocation of the Light Chain to the neuronal cytosol where it acts as a zinc-dependent endoprotease cleaving polypeptides essential for neurotransmitter release.
- Mechanism of action
Botulinum Toxin Type B binds to and cleaves the synaptic Vesicle Associated Membrane Protein (VAMP, also known as synaptobrevin) which is a component of the protein complex responsible for docking and fusion of the synaptic vesicle to the presynaptic membrane, a necessary step to neurotransmitter release.
Target Actions Organism AVesicle-associated membrane protein 2 binderHumans AVesicle-associated membrane protein 1 binderHumans ASynaptotagmin-2 Not Available Humans - Absorption
Though pharmacokinetic or ADME studies were not performed, Botulinum Toxin Type B is not expected to be present in the peripheral blood at measurable levels following IM injection at the recommended doses.
- Volume of distribution
Not Available
- Protein binding
Not Available
- Metabolism
- Not Available
- Route of elimination
Not Available
- Half-life
Not Available
- Clearance
Not Available
- Adverse Effects
Improve decision support & research outcomesWith structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates.Improve decision support & research outcomes with our structured adverse effects data.- Toxicity
One unit of Botulinum Toxin Type B corresponds to the calculated median lethal intraperitoneal dose (LD50) in mice.
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRs
- Not Available
Interactions
- Drug Interactions
- This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
Drug Interaction Integrate drug-drug
interactions in your software1,2-Benzodiazepine The risk or severity of CNS depression can be increased when Botulinum toxin type B is combined with 1,2-Benzodiazepine. Acetazolamide The risk or severity of CNS depression can be increased when Botulinum toxin type B is combined with Acetazolamide. Acetophenazine The risk or severity of CNS depression can be increased when Botulinum toxin type B is combined with Acetophenazine. Aclidinium The risk or severity of adverse effects can be increased when Aclidinium is combined with Botulinum toxin type B. Agomelatine The risk or severity of CNS depression can be increased when Botulinum toxin type B is combined with Agomelatine. Alfentanil The risk or severity of CNS depression can be increased when Botulinum toxin type B is combined with Alfentanil. Alimemazine The risk or severity of CNS depression can be increased when Botulinum toxin type B is combined with Alimemazine. Almotriptan The risk or severity of CNS depression can be increased when Botulinum toxin type B is combined with Almotriptan. Alosetron The risk or severity of CNS depression can be increased when Botulinum toxin type B is combined with Alosetron. Alprazolam The risk or severity of CNS depression can be increased when Botulinum toxin type B is combined with Alprazolam. 
Identify potential medication risksEasily compare up to 40 drugs with our drug interaction checker.Get severity rating, description, and management advice.Learn more - Food Interactions
- No interactions found.
Products
Drug product information from 10+ global regionsOur datasets provide approved product information including:dosage, form, labeller, route of administration, and marketing period.Access drug product information from over 10 global regions.- International/Other Brands
- Neurobloc (Solstice Neurosciences)
- Brand Name Prescription Products
Name Dosage Strength Route Labeller Marketing Start Marketing End Region Image Myobloc Solution 5000 unit / mL Intramuscular Solstice Neurosciences, Llc, A Wholly Owned Subsidiary Of Us Worldmeds, Llc Not applicable Not applicable Canada 
Myobloc Injection, solution 2500 [USP'U]/0.5mL Intramuscular Solstice Neurosciences, LLC 2000-12-08 Not applicable US 
Myobloc Injection, solution 10000 [USP'U]/2mL Intramuscular Solstice Neurosciences, LLC 2000-12-08 Not applicable US Myobloc Injection, solution 5000 [USP'U]/1mL Intramuscular Solstice Neurosciences, LLC 2000-12-08 Not applicable US Neurobloc Injection, solution 5000 U/ml Intramuscular Sloan Pharma S.A.R.L 2022-06-09 2023-05-04 EU 
Neurobloc Injection, solution 5000 U/ml Intramuscular Sloan Pharma S.A.R.L 2023-05-04 2023-05-04 EU Neurobloc Injection, solution 5000 U/ml Intramuscular Sloan Pharma S.A.R.L 2020-12-17 2023-05-04 EU Neurobloc Injection, solution 5000 U/ml Intramuscular Sloan Pharma S.A.R.L 2022-06-09 2023-05-04 EU
Categories
- ATC Codes
- M03AX01 — Botulinum toxin
- Drug Categories
- Acetylcholine Release Inhibitors
- Agents that produce neuromuscular block (indirect)
- Amino Acids, Peptides, and Proteins
- Amphibian Venoms
- Anti-Dyskinesia Agents
- Bacterial Proteins
- Bacterial Toxins
- Biological Factors
- Botulinum Toxins
- Central Nervous System Agents
- Central Nervous System Depressants
- Cholinergic Agents
- Complex Mixtures
- Endopeptidases
- Enzymes
- Enzymes and Coenzymes
- Ganglion Blockers
- Hydrolases
- Membrane Transport Modulators
- Metalloendopeptidases
- Metalloproteases
- Muscle Relaxants
- Muscle Relaxants, Peripherally Acting Agents
- Musculo-Skeletal System
- Neurotoxins
- Neurotransmitter Agents
- Other Miscellaneous Therapeutic Agents
- Peptide Hydrolases
- Proteins
- Toxins, Biological
- Venoms
- Chemical TaxonomyProvided by Classyfire
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
- Affected organisms
- Humans and other mammals
Chemical Identifiers
- UNII
- 0Y70779M1F
- CAS number
- 93384-44-2
References
- General References
- Montecucco C, Molgo J: Botulinal neurotoxins: revival of an old killer. Curr Opin Pharmacol. 2005 Jun;5(3):274-9. [Article]
- Brin MF, Lew MF, Adler CH, Comella CL, Factor SA, Jankovic J, O'Brien C, Murray JJ, Wallace JD, Willmer-Hulme A, Koller M: Safety and efficacy of NeuroBloc (botulinum toxin type B) in type A-resistant cervical dystonia. Neurology. 1999 Oct 22;53(7):1431-8. [Article]
- Shukla HD, Sharma SK: Clostridium botulinum: a bug with beauty and weapon. Crit Rev Microbiol. 2005;31(1):11-8. [Article]
- Eisenach JH, Atkinson JL, Fealey RD: Hyperhidrosis: evolving therapies for a well-established phenomenon. Mayo Clin Proc. 2005 May;80(5):657-66. [Article]
- Schurch B, Corcos J: Botulinum toxin injections for paediatric incontinence. Curr Opin Urol. 2005 Jul;15(4):264-7. [Article]
- External Links
- UniProt
- P10844
- Genbank
- M81186
- KEGG Drug
- D02735
- PubChem Substance
- 46504750
- 860178
- ChEMBL
- CHEMBL1201569
- Therapeutic Targets Database
- DAP001272
- PharmGKB
- PA164747061
- RxList
- RxList Drug Page
- Drugs.com
- Drugs.com Drug Page
- Wikipedia
- Botulinum_toxin
- FDA label
- Download (1.18 MB)
Clinical Trials
- Clinical Trials
Phase Status Purpose Conditions Count 4 Completed Treatment Dystonia, Cervical 1 4 Completed Treatment Focal Dystonia 1 4 Completed Treatment Injuries, Brain / Spasticity Secondary to Either a Disorder or Trauma / Spinal Cord Injuries / Stroke / Tumor 1 4 Terminated Treatment Back Pain Lower Back 1 3 Completed Treatment Sialorrhea 2 3 Not Yet Recruiting Treatment Sialorrhea 1 2 Completed Treatment Drooling 1 2 Completed Treatment Dystonia, Cervical / Torticollis (Spasmodic) 1 2 Completed Treatment Systemic Sclerosis Patients With Digital Ulcers 1 2 Completed Treatment Torticollis (Spasmodic) 1
Pharmacoeconomics
- Manufacturers
- Not Available
- Packagers
- Solstice Neurosciences
- Dosage Forms
Form Route Strength Injection, solution Intramuscular 10000 [USP'U]/2mL Injection, solution Intramuscular 2500 [USP'U]/0.5mL Injection, solution Intramuscular 5000 [USP'U]/1mL Solution Intramuscular 5000 unit / mL Injection, solution Intramuscular 5000 U/ML - Prices
Unit description Cost Unit Myobloc 10000 unit/2ml Solution 2ml Vial 1245.5USD vial Myobloc 2500 unit/0.5 ml vial 299.4USD vial DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.- Patents
- Not Available
Properties
- State
- Liquid
- Experimental Properties
- Not Available
Targets
Build, predict & validate machine-learning models
Use our structured and evidence-based datasets to unlock newinsights and accelerate drug research.
Use our structured and evidence-based datasets to unlock new insights and accelerate drug research.
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- Actions
- Binder
- General Function
- Syntaxin-1 binding
- Specific Function
- Involved in the targeting and/or fusion of transport vesicles to their target membrane. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.
- Gene Name
- VAMP2
- Uniprot ID
- P63027
- Uniprot Name
- Vesicle-associated membrane protein 2
- Molecular Weight
- 12662.585 Da
References
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- Actions
- Binder
- General Function
- Snare binding
- Specific Function
- Involved in the targeting and/or fusion of transport vesicles to their target membrane.
- Gene Name
- VAMP1
- Uniprot ID
- P23763
- Uniprot Name
- Vesicle-associated membrane protein 1
- Molecular Weight
- 12901.815 Da
References
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [Article]
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [Article]
- Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [Article]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- General Function
- Syntaxin binding
- Specific Function
- Exhibits calcium-dependent phospholipid and inositol polyphosphate binding properties (By similarity). May have a regulatory role in the membrane interactions during trafficking of synaptic vesicle...
- Gene Name
- SYT2
- Uniprot ID
- Q8N9I0
- Uniprot Name
- Synaptotagmin-2
- Molecular Weight
- 46871.95 Da
References
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [Article]
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [Article]
- Poulain B, Lonchamp E, Jover E, Popoff MR, Molgo J: [Mechanisms of action of botulinum toxins and neurotoxins]. Ann Dermatol Venereol. 2009 May;136 Suppl 4:S73-6. doi: 10.1016/S0151-9638(09)74531-4. [Article]
Drug created at June 13, 2005 13:24 / Updated at June 03, 2023 08:16