Sodium-dependent serotonin transporter
Details
- Name
- Sodium-dependent serotonin transporter
- Synonyms
- 5HT transporter
- 5HTT
- HTT
- SERT
- Solute carrier family 6 member 4
- Gene Name
- SLC6A4
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0001494|Sodium-dependent serotonin transporter METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTR HSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLP YTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIM AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIH RSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGA TLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQD ALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVT LTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRIC WVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIIT PGTFKERIIKSITPETPTEIPCGDIRLNAV
- Number of residues
- 630
- Molecular Weight
- 70324.165
- Theoretical pI
- 6.17
- GO Classification
- Functionsactin filament binding / cocaine binding / monoamine transmembrane transporter activity / Rab GTPase binding / serotonin / serotonin transmembrane transporter activityProcessesbrain morphogenesis / cellular response to cGMP / cellular response to retinoic acid / circadian rhythm / memory / monoamine transport / negative regulation of cerebellar granule cell precursor proliferation / negative regulation of neuron differentiation / negative regulation of organ growth / negative regulation of synaptic transmission, dopaminergic / positive regulation of cell cycle / positive regulation of gene expression / protein homooligomerization / protein oligomerization / response to drug / response to estradiol / response to hypoxia / response to nutrient / response to toxic substance / serotonin transport / serotonin uptake / social behavior / sperm ejaculation / synaptic transmission / thalamus development / vasoconstrictionComponentscytosol / endomembrane system / endosome membrane / integral component of plasma membrane / membrane raft / neuron projection / plasma membrane
- General Function
- Serotonin:sodium symporter activity
- Specific Function
- Serotonin transporter whose primary function in the central nervous system involves the regulation of serotonergic signaling via transport of serotonin molecules from the synaptic cleft back into the pre-synaptic terminal for re-utilization. Plays a key role in mediating regulation of the availability of serotonin to other receptors of serotonergic systems. Terminates the action of serotonin and recycles it in a sodium-dependent manner.
- Pfam Domain Function
- Transmembrane Regions
- 88-108 116-135 160-180 253-271 280-297 333-350 362-383 417-436 464-482 498-518 539-558 577-595
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0021275|Sodium-dependent serotonin transporter (SLC6A4) ATGGAGACGACGCCCTTGAATTCTCAGAAGCAGCTATCAGCGTGTGAAGATGGAGAAGAT TGTCAGGAAAACGGAGTTCTACAGAAGGTTGTTCCCACCCCAGGGGACAAAGTGGAGTCC GGGCAAATATCCAATGGGTACTCAGCAGTTCCAAGTCCTGGTGCGGGAGATGACACACGG CACTCTATCCCAGCGACCACCACCACCCTAGTGGCTGAGCTTCATCAAGGGGAACGGGAG ACCTGGGGCAAGAAGGTGGATTTCCTTCTCTCAGTGATTGGCTATGCTGTGGACCTGGGC AATGTCTGGCGCTTCCCCTACATATGTTACCAGAATGGAGGGGGGGCATTCCTCCTCCCC TACACCATCATGGCCATTTTTGGGGGAATCCCGCTCTTTTACATGGAGCTCGCACTGGGA CAGTACCACCGAAATGGATGCATTTCAATATGGAGGAAAATCTGCCCGATTTTCAAAGGG ATTGGTTATGCCATCTGCATCATTGCCTTTTACATTGCTTCCTACTACAACACCATCATG GCCTGGGCGCTATACTACCTCATCTCCTCCTTCACGGACCAGCTGCCCTGGACCAGCTGC AAGAACTCCTGGAACACTGGCAACTGCACCAATTACTTCTCCGAGGACAACATCACCTGG ACCCTCCATTCCACGTCCCCTGCTGAAGAATTTTACACGCGCCACGTCCTGCAGATCCAC CGGTCTAAGGGGCTCCAGGACCTGGGGGGCATCAGCTGGCAGCTGGCCCTCTGCATCATG CTGATCTTCACTGTTATCTACTTCAGCATCTGGAAAGGCGTCAAGACCTCTGGCAAGGTG GTGTGGGTGACAGCCACCTTCCCTTATATCATCCTTTCTGTCCTGCTGGTGAGGGGTGCC ACCCTCCCTGGAGCCTGGAGGGGTGTTCTCTTCTACTTGAAACCCAATTGGCAGAAACTC CTGGAGACAGGGGTGTGGATAGATGCAGCCGCTCAGATCTTCTTCTCTCTTGGTCCGGGC TTTGGGGTCCTGCTGGCTTTTGCTAGCTACAACAAGTTCAACAACAACTGCTACCAAGAT GCCCTGGTGACCAGCGTGGTGAACTGCATGACGAGCTTCGTTTCGGGATTTGTCATCTTC ACAGTGCTCGGTTACATGGCTGAGATGAGGAATGAAGATGTGTCTGAGGTGGCCAAAGAC GCAGGTCCCAGCCTCCTCTTCATCACGTATGCAGAAGCGATAGCCAACATGCCAGCGTCC ACTTTCTTTGCCATCATCTTCTTTCTGATGTTAATCACGCTGGGCTTGGACAGCACGTTT GCAGGCTTGGAGGGGGTGATCACGGCTGTGCTGGATGAGTTCCCACACGTCTGGGCCAAG CGCCGGGAGCGGTTCGTGCTCGCCGTGGTCATCACCTGCTTCTTTGGATCCCTGGTCACC CTGACTTTTGGAGGGGCCTACGTGGTGAAGCTGCTGGAGGAGTATGCCACGGGGCCCGCA GTGCTCACTGTCGCGCTGATCGAAGCAGTCGCTGTGTCTTGGTTCTATGGCATCACTCAG TTCTGCAGGGACGTGAAGGAAATGCTCGGCTTCAGCCCGGGGTGGTTCTGGAGGATCTGC TGGGTGGCCATCAGCCCTCTGTTTCTCCTGTTCATCATTTGCAGTTTTCTGATGAGCCCG CCACAACTACGACTTTTCCAATATAATTATCCTTACTGGAGTATCATCTTGGGTTACTGC ATAGGAACCTCATCTTTCATTTGCATCCCCACATATATAGCTTATCGGTTGATCATCACT CCAGGGACATTTAAAGAGCGTATTATTAAAAGTATTACCCCAGAAACACCAACAGAAATT CCTTGTGGGGACATCCGCTTGAATGCTGTGTAA
- Chromosome Location
- 17
- Locus
- 17q11.1-q12
- External Identifiers
Resource Link UniProtKB ID P31645 UniProtKB Entry Name SC6A4_HUMAN GenBank Protein ID 36433 GenBank Gene ID X70697 GenAtlas ID SLC6A4 HGNC ID HGNC:11050 - General References
- Lesch KP, Wolozin BL, Estler HC, Murphy DL, Riederer P: Isolation of a cDNA encoding the human brain serotonin transporter. J Neural Transm Gen Sect. 1993;91(1):67-72. [Article]
- Ramamoorthy S, Bauman AL, Moore KR, Han H, Yang-Feng T, Chang AS, Ganapathy V, Blakely RD: Antidepressant- and cocaine-sensitive human serotonin transporter: molecular cloning, expression, and chromosomal localization. Proc Natl Acad Sci U S A. 1993 Mar 15;90(6):2542-6. [Article]
- Lesch KP, Wolozin BL, Murphy DL, Reiderer P: Primary structure of the human platelet serotonin uptake site: identity with the brain serotonin transporter. J Neurochem. 1993 Jun;60(6):2319-22. [Article]
- Iceta R, Mesonero JE, Aramayona JJ, Alcalde AI: Molecular characterization and intracellular regulation of the human serotonin transporter in Caco-2 cells. J Physiol Pharmacol. 2006 Mar;57(1):119-30. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
- Carneiro AM, Blakely RD: Serotonin-, protein kinase C-, and Hic-5-associated redistribution of the platelet serotonin transporter. J Biol Chem. 2006 Aug 25;281(34):24769-80. Epub 2006 Jun 27. [Article]
- Muller HK, Wiborg O, Haase J: Subcellular redistribution of the serotonin transporter by secretory carrier membrane protein 2. J Biol Chem. 2006 Sep 29;281(39):28901-9. Epub 2006 Jul 26. [Article]
- Brenner B, Harney JT, Ahmed BA, Jeffus BC, Unal R, Mehta JL, Kilic F: Plasma serotonin levels and the platelet serotonin transporter. J Neurochem. 2007 Jul;102(1):206-15. Epub 2007 May 15. [Article]
- Zhang YW, Gesmonde J, Ramamoorthy S, Rudnick G: Serotonin transporter phosphorylation by cGMP-dependent protein kinase is altered by a mutation associated with obsessive compulsive disorder. J Neurosci. 2007 Oct 3;27(40):10878-86. [Article]
- Ahmed BA, Jeffus BC, Bukhari SI, Harney JT, Unal R, Lupashin VV, van der Sluijs P, Kilic F: Serotonin transamidates Rab4 and facilitates its binding to the C terminus of serotonin transporter. J Biol Chem. 2008 Apr 4;283(14):9388-98. doi: 10.1074/jbc.M706367200. Epub 2008 Jan 28. [Article]
- Ahmed BA, Bukhari IA, Jeffus BC, Harney JT, Thyparambil S, Ziu E, Fraer M, Rusch NJ, Zimniak P, Lupashin V, Tang D, Kilic F: The cellular distribution of serotonin transporter is impeded on serotonin-altered vimentin network. PLoS One. 2009;4(3):e4730. doi: 10.1371/journal.pone.0004730. Epub 2009 Mar 9. [Article]
- Annamalai B, Mannangatti P, Arapulisamy O, Shippenberg TS, Jayanthi LD, Ramamoorthy S: Tyrosine phosphorylation of the human serotonin transporter: a role in the transporter stability and function. Mol Pharmacol. 2012 Jan;81(1):73-85. doi: 10.1124/mol.111.073171. Epub 2011 Oct 12. [Article]
- Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES: Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. 1999 Jul;22(3):231-8. [Article]
- Ozaki N, Goldman D, Kaye WH, Plotnicov K, Greenberg BD, Lappalainen J, Rudnick G, Murphy DL: Serotonin transporter missense mutation associated with a complex neuropsychiatric phenotype. Mol Psychiatry. 2003 Nov;8(11):933-6. [Article]
- Kilic F, Murphy DL, Rudnick G: A human serotonin transporter mutation causes constitutive activation of transport activity. Mol Pharmacol. 2003 Aug;64(2):440-6. [Article]
- Caspi A, Sugden K, Moffitt TE, Taylor A, Craig IW, Harrington H, McClay J, Mill J, Martin J, Braithwaite A, Poulton R: Influence of life stress on depression: moderation by a polymorphism in the 5-HTT gene. Science. 2003 Jul 18;301(5631):386-9. [Article]
- Feinn R, Nellissery M, Kranzler HR: Meta-analysis of the association of a functional serotonin transporter promoter polymorphism with alcohol dependence. Am J Med Genet B Neuropsychiatr Genet. 2005 Feb 5;133B(1):79-84. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB00176 Fluvoxamine approved, investigational yes inhibitor Details DB00215 Citalopram approved yes inhibitor Details DB00285 Venlafaxine approved yes inhibitor Details DB00321 Amitriptyline approved yes inhibitor Details DB00472 Fluoxetine approved, vet_approved yes inhibitor Details DB00476 Duloxetine approved yes inhibitor Details DB00540 Nortriptyline approved yes inhibitor Details DB00543 Amoxapine approved yes inhibitor Details DB00715 Paroxetine approved, investigational yes inhibitor Details DB00726 Trimipramine approved yes inhibitor Details DB01104 Sertraline approved yes inhibitorbinderdownregulator Details DB01105 Sibutramine approved, illicit, investigational, withdrawn yes inhibitor Details DB01142 Doxepin approved, investigational yes inhibitor Details DB01175 Escitalopram approved yes inhibitor Details DB01191 Dexfenfluramine approved, illicit, investigational, withdrawn yes inhibitor Details DB01242 Clomipramine approved, investigational, vet_approved yes inhibitor Details DB00344 Protriptyline approved yes inhibitor Details DB00458 Imipramine approved yes inhibitor Details DB00514 Dextromethorphan approved unknown inhibitor Details DB00656 Trazodone approved, investigational yes inhibitor Details DB00805 Minaprine approved unknown inhibitor Details DB00907 Cocaine approved, illicit yes inhibitor Details DB01149 Nefazodone approved, withdrawn yes inhibitor Details DB01151 Desipramine approved, investigational yes inhibitor Details DB01454 Midomafetamine experimental, illicit, investigational yes negative modulator Details DB04832 Zimelidine approved, withdrawn unknown Details DB04836 Amineptine illicit, withdrawn unknown Details DB01442 MMDA experimental, illicit yes negative modulator Details DB00191 Phentermine approved, illicit yes inhibitor Details DB04889 Bicifadine investigational unknown Details DB04896 Milnacipran approved, investigational yes inhibitor Details DB05422 OPC-14523 investigational unknown Details DB05688 CRx-119 investigational unknown Details DB00193 Tramadol approved, investigational yes inhibitor Details DB12305 Dasotraline investigational unknown Details DB06156 Tesofensine investigational unknown Details DB05964 Amitifadine investigational unknown Details DB06148 Mianserin approved, investigational unknown inhibitor Details DB00289 Atomoxetine approved unknown binder Details DB00661 Verapamil approved unknown unknown Details DB00579 Mazindol approved, investigational yes inhibitor Details DB01114 Chlorpheniramine approved unknown inhibitor Details DB00574 Fenfluramine approved, illicit, investigational, withdrawn yes substrateinhibitor Details DB01079 Tegaserod approved, investigational, withdrawn unknown substrateinhibitor Details DB06700 Desvenlafaxine approved, investigational yes inhibitor Details DB06701 Dexmethylphenidate approved, investigational unknown inhibitor Details DB00852 Pseudoephedrine approved yes inhibitor Details DB01472 4-Methoxyamphetamine experimental, illicit yes inhibitor Details DB01577 Metamfetamine approved, illicit yes negative modulator Details DB01363 Ephedra sinica root nutraceutical yes negative modulator Details DB01454 Midomafetamine experimental, illicit, investigational unknown Details DB06204 Tapentadol approved unknown inhibitor Details DB08918 Levomilnacipran approved, investigational yes inhibitor Details DB00408 Loxapine approved unknown binder Details DB00182 Amphetamine approved, illicit, investigational unknown binder Details DB00988 Dopamine approved unknown inhibitor Details DB00454 Meperidine approved unknown binder Details DB09016 Butriptyline approved, withdrawn yes antagonistinhibitor Details DB09068 Vortioxetine approved, investigational yes inhibitor Details DB09167 Dosulepin approved yes inhibitor Details DB08839 Serotonin investigational, nutraceutical unknown Details DB09186 Nisoxetine experimental unknown Details DB04821 Nomifensine approved, withdrawn unknown Details DB09194 Etoperidone withdrawn no inhibitor Details DB09195 Lorpiprazole approved yes antagonist Details DB09225 Zotepine approved, investigational, withdrawn yes antagonist Details DB00245 Benzatropine approved no inhibitor Details DB06684 Vilazodone approved yes inhibitor Details DB00370 Mirtazapine approved unknown substrateinhibitor Details DB00924 Cyclobenzaprine approved unknown inhibitor Details DB01238 Aripiprazole approved, investigational unknown modulator Details DB06077 Lumateperone approved, investigational yes inhibitor Details DB00852 Pseudoephedrine approved unknown inhibitor Details DB00721 Procaine approved, investigational, vet_approved unknown inhibitor Details DB00574 Fenfluramine approved, illicit, investigational, withdrawn yes substrateinhibitor Details