Sex hormone-binding globulin
Details
- Name
- Sex hormone-binding globulin
- Kind
- protein
- Synonyms
- ABP
- SBP
- Sex steroid-binding protein
- SHBG
- TeBG
- Testis-specific androgen-binding protein
- Testosterone-estradiol-binding globulin
- Testosterone-estrogen-binding globulin
- Gene Name
- SHBG
- UniProtKB Entry
- P04278Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0001366|Sex hormone-binding globulin MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMT FDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGA GPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPAS NLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDI PQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPL VLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTS FCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH
- Number of residues
- 402
- Molecular Weight
- 43778.755
- Theoretical pI
- 6.7
- GO Classification
- Functionssteroid binding
- General Function
- Functions as an androgen transport protein, but may also be involved in receptor mediated processes. Each dimer binds one molecule of steroid. Specific for 5-alpha-dihydrotestosterone, testosterone, and 17-beta-estradiol. Regulates the plasma metabolic clearance rate of steroid hormones by controlling their plasma concentration
- Specific Function
- androgen binding
- Pfam Domain Function
- Laminin_G_1 (PF00054)
- Signal Regions
- 1-29
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0010477|Sex hormone-binding globulin (SHBG) ATGGAGAGCAGAGGCCCACTGGCTACCTCGCGCCTGCTGCTGTTGCTGCTGTTGCTACTA CTGCGTCACACCCGCCAGGGATGGGCCCTGAGACCTGTTCTCCCCACCCAGAGTGCCCAC GACCCTCCGGCTGTCCACCTCAGCAATGGCCCAGGACAAGAGCCTATCGCTGTCATGACC TTTGACCTCACCAAGATCACAAAAACCTCCTCCTCCTTTGAGGTTCGAACCTGGGACCCA GAGGGAGTGATTTTTTATGGGGATACCAACCCTAAGGATGACTGGTTTATGCTGGGACTT CGAGACGGCAGGCCTGAGATCCAACTGCACAATCACTGGGCCCAGCTTACGGTGGGTGCT GGACCACGGCTGGATGATGGGAGATGGCACCAGGTGGAAGTCAAGATGGAGGGGGACTCT GTGCTGCTGGAGGTGGATGGGGAGGAGGTGCTGCGCCTGAGACAGGTCTCTGGGCCCCTG ACCAGCAAACGCCATCCCATCATGAGGATTGCGCTTGGGGGGCTGCTCTTCCCCGCTTCC AACCTTCGGTTGCCGCTGGTTCCTGCCCTGGATGGCTGCCTGCGCCGGGATTCCTGGCTG GACAAACAGGCCGAGATCTCAGCATCTGCCCCCACTAGCCTCAGAAGCTGTGATGTAGAA TCAAATCCCGGGATATTTCTCCCTCCAGGGACTCAGGCAGAATTCAATCTCCGAGACATT CCCCAGCCTCATGCAGAGCCCTGGGCCTTCTCTTTGGACCTGGGACTCAAGCAGGCAGCA GGCTCAGGCCACCTCCTTGCTCTTGGGACACCAGAGAACCCATCTTGGCTCAGTCTCCAC CTCCAAGATCAAAAGGTGGTGTTGTCTTCTGGGTCGGGGCCAGGGCTGGATCTGCCCCTG GTCTTGGGACTCCCTCTTCAGCTGAAGCTGAGTATGTCCAGGGTGGTCTTGAGCCAAGGG TCGAAGATGAAGGCCCTTGCCCTGCCTCCCTTAGGCCTGGCTCCCCTCCTTAACCTCTGG GCCAAGCCTCAAGGGCGTCTCTTCCTGGGGGCTTTACCAGGAGAAGACTCTTCCACCTCT TTTTGCCTGAATGGCCTTTGGGCACAAGGTCAGAGGCTGGATGTGGACCAGGCCCTGAAC AGAAGCCATGAGATCTGGACTCACAGCTGCCCCCAGAGCCCAGGCAATGGCACTGACGCT TCCCATTAA
- Chromosome Location
- 17
- Locus
- 17p13.1
- External Identifiers
Resource Link UniProtKB ID P04278 UniProtKB Entry Name SHBG_HUMAN GenBank Protein ID 296673 GenBank Gene ID X16349 GeneCard ID SHBG GenAtlas ID SHBG HGNC ID HGNC:10839 PDB ID(s) 1D2S, 1F5F, 1KDK, 1KDM, 1LHN, 1LHO, 1LHU, 1LHV, 1LHW, 6PYA, 6PYB, 6PYF, 6ULB KEGG ID hsa:6462 NCBI Gene ID 6462 - General References
- Gershagen S, Lundwall A, Fernlund P: Characterization of the human sex hormone binding globulin (SHBG) gene and demonstration of two transcripts in both liver and testis. Nucleic Acids Res. 1989 Nov 25;17(22):9245-58. [Article]
- Hammond GL, Underhill DA, Rykse HM, Smith CL: The human sex hormone-binding globulin gene contains exons for androgen-binding protein and two other testicular messenger RNAs. Mol Endocrinol. 1989 Nov;3(11):1869-76. [Article]
- Jin P, Fu GK, Wilson AD, Yang J, Chien D, Hawkins PR, Au-Young J, Stuve LL: PCR isolation and cloning of novel splice variant mRNAs from known drug target genes. Genomics. 2004 Apr;83(4):566-71. [Article]
- Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Hammond GL, Underhill DA, Smith CL, Goping IS, Harley MJ, Musto NA, Cheng CY, Bardin CW: The cDNA-deduced primary structure of human sex hormone-binding globulin and location of its steroid-binding domain. FEBS Lett. 1987 May 4;215(1):100-4. [Article]
- Gershagen S, Fernlund P, Lundwall A: A cDNA coding for human sex hormone binding globulin. Homology to vitamin K-dependent protein S. FEBS Lett. 1987 Aug 10;220(1):129-35. [Article]
- Que BG, Petra PH: Characterization of a cDNA coding for sex steroid-binding protein of human plasma. FEBS Lett. 1987 Jul 27;219(2):405-9. [Article]
- Hammond GL, Robinson PA, Sugino H, Ward DN, Finne J: Physicochemical characteristics of human sex hormone binding globulin: evidence for two identical subunits. J Steroid Biochem. 1986 Apr;24(4):815-24. [Article]
- Walsh KA, Titani K, Takio K, Kumar S, Hayes R, Petra PH: Amino acid sequence of the sex steroid binding protein of human blood plasma. Biochemistry. 1986 Nov 18;25(23):7584-90. [Article]
- Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [Article]
- Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [Article]
- Power SG, Bocchinfuso WP, Pallesen M, Warmels-Rodenhiser S, Van Baelen H, Hammond GL: Molecular analyses of a human sex hormone-binding globulin variant: evidence for an additional carbohydrate chain. J Clin Endocrinol Metab. 1992 Oct;75(4):1066-70. [Article]
- Grishkovskaya I, Avvakumov GV, Sklenar G, Dales D, Hammond GL, Muller YA: Crystal structure of human sex hormone-binding globulin: steroid transport by a laminin G-like domain. EMBO J. 2000 Feb 15;19(4):504-12. [Article]
- Grishkovskaya I, Avvakumov GV, Hammond GL, Catalano MG, Muller YA: Steroid ligands bind human sex hormone-binding globulin in specific orientations and produce distinct changes in protein conformation. J Biol Chem. 2002 Aug 30;277(35):32086-93. Epub 2002 Jun 13. [Article]
- Hardy DO, Carino C, Catterall JF, Larrea F: Molecular characterization of a genetic variant of the steroid hormone-binding globulin gene in heterozygous subjects. J Clin Endocrinol Metab. 1995 Apr;80(4):1253-6. [Article]
- Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES: Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. 1999 Jul;22(3):231-8. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Drostanolone illicit unknown carrier Details Fluoxymesterone approved, illicit unknown carrier antagonist Details Hydrocortisone approved, vet_approved unknown carrier binder Details Estradiol approved, investigational, vet_approved unknown carrier binder Details Danazol approved no carrier antagonist Details Stanolone illicit, investigational unknown carrier Details 5-Alpha-Androstane-3-Beta,17beta-Diol experimental unknown carrier Details 5alpha-androstane-3beta,17alpha-diol experimental unknown carrier Details Mitotane approved unknown carrier upregulator Details 2-Methoxyestradiol investigational unknown carrier Details Oxymetholone approved, illicit unknown carrier Details Testosterone approved, investigational no carrier binder Details Estrone sulfate approved unknown carrier Details Methyltestosterone approved unknown carrier Details Norethisterone approved unknown carrier substrate Details Levonorgestrel approved, investigational unknown target inhibitorbinder Details Zinc approved, investigational unknown target Details 4'-Hydroxyflavanone experimental unknown target Details Afimoxifene investigational unknown target Details Clomifene approved, investigational unknown target Details Dienestrol approved, investigational unknown target Details Diethylstilbestrol approved, investigational, withdrawn unknown target Details Dioxybenzone approved unknown target binder Details Equol investigational unknown target Details Estriol approved, investigational, vet_approved unknown target Details Estrone approved unknown target Details Genistein investigational unknown target Details Hesperetin experimental unknown target Details Masoprocol approved, investigational unknown target Details Naringenin experimental unknown target Details Norethynodrel approved unknown target Details Phenolphthalein approved, withdrawn unknown target Details Progesterone approved, vet_approved unknown target binderpotentiator Details Quercetin experimental, investigational unknown target Details Tamoxifen approved yes target inducer Details Toremifene approved, investigational unknown target Details Zeranol experimental, vet_approved unknown target Details Medrogestone approved, withdrawn no carrier binder Details Testosterone cypionate approved no carrier other/unknown Details Testosterone enanthate approved no carrier other/unknown Details Testosterone undecanoate approved, investigational no carrier binder Details Stanolone acetate experimental unknown carrier Details Estradiol acetate approved, investigational, vet_approved unknown carrier Details Estradiol benzoate approved, investigational, vet_approved unknown carrier Details Estradiol cypionate approved, investigational, vet_approved unknown carrier Details Estradiol dienanthate approved, investigational, vet_approved unknown carrier Details Estradiol valerate approved, investigational, vet_approved unknown carrier Details Testosterone propionate approved, investigational, vet_approved, withdrawn no carrier substrate Details Gestrinone approved unknown target antagonist Details Zinc acetate approved, investigational unknown target Details Zinc chloride approved, investigational unknown target modulator Details Hydrocortisone aceponate experimental, vet_approved unknown carrier Details Hydrocortisone acetate approved, vet_approved unknown carrier Details Hydrocortisone butyrate approved, vet_approved unknown carrier Details Hydrocortisone cypionate approved, investigational, vet_approved unknown carrier Details Hydrocortisone phosphate approved, vet_approved unknown carrier Details Hydrocortisone probutate approved, vet_approved unknown carrier Details Hydrocortisone valerate approved, vet_approved unknown carrier Details Estriol tripropionate experimental unknown target Details Conjugated estrogens approved no carrier binder Details Etonogestrel approved, investigational no carrier binder Details Desogestrel approved no carrier binder Details Ketoconazole approved, investigational unknown carrier ligand Details Norgestimate approved, investigational unknown carrier binder Details Ethinylestradiol approved unknown carrier binder Details Zinc sulfate, unspecified form approved, experimental unknown target modulator Details Fluoroestradiol F-18 approved unknown carrier binder Details Daptomycin approved, investigational no carrier binder Details Nandrolone decanoate approved, illicit unknown carrier binder Details