D(3) dopamine receptor
Details
- Name
- D(3) dopamine receptor
- Kind
- protein
- Synonyms
- Dopamine D3 receptor
- Gene Name
- DRD3
- UniProtKB Entry
- P35462Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0056347|D(3) dopamine receptor MASLSQLSGHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
- Number of residues
- 400
- Molecular Weight
- 44194.315
- Theoretical pI
- 9.07
- GO Classification
- FunctionsG protein-coupled receptor activityProcessesadenylate cyclase-activating adrenergic receptor signaling pathway / G protein-coupled receptor internalization / G protein-coupled receptor signaling pathway / intracellular calcium ion homeostasis / negative regulation of cytosolic calcium ion concentration / negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction / negative regulation of synaptic transmission, glutamatergic / phospholipase C-activating dopamine receptor signaling pathway / positive regulation of MAPK cascade / regulation of potassium ion transport / response to xenobiotic stimulusComponentssynapse
- General Function
- Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase. Promotes cell proliferation
- Specific Function
- dopamine neurotransmitter receptor activity, coupled via Gi/Go
- Pfam Domain Function
- 7tm_1 (PF00001)
- Signal Regions
- Not Available
- Transmembrane Regions
- 33-55 66-88 105-126 150-170 188-209 330-351 367-386
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0021269|D(3) dopamine receptor (DRD3) ATGGCATCTCTGAGCCAGCTGAGTGGCCACCTGAACTACACCTGTGGGGCAGAGAACTCC ACAGGTGCCAGCCAGGCCCGCCCACATGCCTACTATGCCCTCTCCTACTGCGCGCTCATC CTGGCCATCGTCTTCGGCAATGGCCTGGTGTGCATGGCTGTGCTGAAGGAGCGGGCCCTG CAGACTACCACCAACTACTTAGTAGTGAGCCTGGCTGTGGCAGACTTGCTGGTGGCCACC TTGGTGATGCCCTGGGTGGTATACCTGGAGGTGACAGGTGGAGTCTGGAATTTCAGCCGC ATTTGCTGTGATGTTTTTGTCACCCTGGATGTCATGATGTGTACAGCCAGCATCCTTAAT CTCTGTGCCATCAGCATAGACAGGTACACTGCAGTGGTCATGCCCGTTCACTACCAGCAT GGCACGGGACAGAGCTCCTGTCGGCGCGTGGCCCTCATGATCACGGCCGTCTGGGTACTG GCCTTTGCTGTGTCCTGCCCTCTTCTGTTTGGCTTTAATACCACAGGGGACCCCACTGTC TGCTCCATCTCCAACCCTGATTTTGTCATCTACTCTTCAGTGGTGTCCTTCTACCTGCCC TTTGGAGTGACTGTCCTTGTCTATGCCAGAATCTATGTGGTGCTGAAACAAAGGAGACGG AAAAGGATCCTCACTCGACAGAACAGTCAGTGCAACAGTGTCAGGCCTGGCTTCCCCCAA CAAACCCTCTCTCCTGACCCGGCACATCTGGAGCTGAAGCGTTACTACAGCATCTGCCAG GACACTGCCTTGGGTGGACCAGGCTTCCAAGAAAGAGGAGGAGAGTTGAAAAGAGAGGAG AAGACTCGGAATTCCCTGAGTCCCACCATAGCGCCCAAGCTCAGCTTAGAAGTTCGAAAA CTCAGCAATGGCAGATTATCGACATCTTTGAAGCTGGGGCCCCTGCAACCTCGGGGAGTG CCACTTCGGGAGAAGAAGGCAACCCAAATGGTGGCCATTGTGCTTGGGGCCTTCATTGTC TGCTGGCTGCCCTTCTTCTTGACCCATGTTCTCAATACCCACTGCCAGACATGCCACGTG TCCCCAGAGCTTTACAGTGCCACGACATGGCTGGGCTACGTGAATAGCGCCCTCAACCCT GTGATCTATACCACCTTCAATATCGAGTTCCGGAAAGCCTTCCTCAAGATCCTGTCTTGC TGA
- Chromosome Location
- 3
- Locus
- 3q13.31
- External Identifiers
Resource Link UniProtKB ID P35462 UniProtKB Entry Name DRD3_HUMAN GenBank Protein ID 927342 GenBank Gene ID U32499 GeneCard ID DRD3 GenAtlas ID DRD3 HGNC ID HGNC:3024 PDB ID(s) 3PBL, 7CMU, 7CMV, 8IRT KEGG ID hsa:1814 IUPHAR/Guide To Pharmacology ID 216 NCBI Gene ID 1814 - General References
- Giros B, Martres MP, Sokoloff P, Schwartz JC: [Gene cloning of human dopaminergic D3 receptor and identification of its chromosome]. C R Acad Sci III. 1990;311(13):501-8. [Article]
- Schmauss C, Haroutunian V, Davis KL, Davidson M: Selective loss of dopamine D3-type receptor mRNA expression in parietal and motor cortices of patients with chronic schizophrenia. Proc Natl Acad Sci U S A. 1993 Oct 1;90(19):8942-6. [Article]
- Liu K, Bergson C, Levenson R, Schmauss C: On the origin of mRNA encoding the truncated dopamine D3-type receptor D3nf and detection of D3nf-like immunoreactivity in human brain. J Biol Chem. 1994 Nov 18;269(46):29220-6. [Article]
- Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Basile M, Lin R, Kabbani N, Karpa K, Kilimann M, Simpson I, Kester M: Paralemmin interacts with D3 dopamine receptors: implications for membrane localization and cAMP signaling. Arch Biochem Biophys. 2006 Feb 1;446(1):60-8. Epub 2005 Dec 1. [Article]
- Villar VA, Jones JE, Armando I, Palmes-Saloma C, Yu P, Pascua AM, Keever L, Arnaldo FB, Wang Z, Luo Y, Felder RA, Jose PA: G protein-coupled receptor kinase 4 (GRK4) regulates the phosphorylation and function of the dopamine D3 receptor. J Biol Chem. 2009 Aug 7;284(32):21425-34. doi: 10.1074/jbc.M109.003665. Epub 2009 Jun 11. [Article]
- Chien EY, Liu W, Zhao Q, Katritch V, Han GW, Hanson MA, Shi L, Newman AH, Javitch JA, Cherezov V, Stevens RC: Structure of the human dopamine D3 receptor in complex with a D2/D3 selective antagonist. Science. 2010 Nov 19;330(6007):1091-5. doi: 10.1126/science.1197410. [Article]
- Chen CH, Liu MY, Wei FC, Koong FJ, Hwu HG, Hsiao KJ: Further evidence of no association between Ser9Gly polymorphism of dopamine D3 receptor gene and schizophrenia. Am J Med Genet. 1997 Feb 21;74(1):40-3. [Article]
- Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES: Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. 1999 Jul;22(3):231-8. [Article]
- Lucotte G, Lagarde JP, Funalot B, Sokoloff P: Linkage with the Ser9Gly DRD3 polymorphism in essential tremor families. Clin Genet. 2006 May;69(5):437-40. [Article]
- Jeanneteau F, Funalot B, Jankovic J, Deng H, Lagarde JP, Lucotte G, Sokoloff P: A functional variant of the dopamine D3 receptor is associated with risk and age-at-onset of essential tremor. Proc Natl Acad Sci U S A. 2006 Jul 11;103(28):10753-8. Epub 2006 Jun 29. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Ziprasidone approved unknown target antagonist Details Ropinirole approved, investigational yes target agonist Details Pramipexole approved, investigational yes target agonist Details Methotrimeprazine approved, investigational unknown target antagonist Details Chlorprothixene approved, experimental, investigational, withdrawn yes target antagonist Details Apomorphine approved, investigational yes target agonist Details Olanzapine approved, investigational unknown target antagonist Details Pardoprunox investigational unknown target Details Norclozapine investigational unknown target Details Asenapine approved unknown target antagonist Details Sumanirole investigational unknown target Details Amisulpride approved, investigational yes target antagonist Details Pergolide approved, investigational, vet_approved, withdrawn yes target agonist Details Bromocriptine approved, investigational, withdrawn yes target agonist Details Lisuride approved, investigational yes target agonist Details Cabergoline approved unknown target agonist Details Rotigotine approved yes target agonist Details Haloperidol approved unknown target inverse agonist Details Paliperidone approved yes target antagonist Details Clozapine approved unknown target antagonist Details Aripiprazole approved, investigational unknown target antagonistpartial agonist Details Quetiapine approved unknown target ligand Details Remoxipride approved, withdrawn unknown target antagonist Details Yohimbine approved, investigational, vet_approved unknown target antagonist Details Sulpiride approved, investigational unknown target antagonist Details Dopamine approved yes target agonist Details Levodopa approved yes target agonist Details Pimozide approved yes target antagonist Details Domperidone approved, investigational, vet_approved yes target antagonist Details Iloperidone approved unknown target antagonist Details Chlorpromazine approved, investigational, vet_approved unknown target inhibitor Details Loxapine approved unknown target binder Details Amoxapine approved unknown target antagonist Details Mianserin approved, investigational unknown target binder Details Captodiame experimental yes target agonist Details AS-8112 experimental unknown target antagonist Details Tiapride investigational yes target blocker Details Piribedil investigational yes target agonist Details Sarizotan investigational unknown target ligand Details Blonanserin investigational yes target antagonist Details Pipamperone investigational unknown target Details Dihydro-alpha-ergocryptine approved yes target partial agonist Details Tianeptine investigational unknown target agonist Details Aripiprazole lauroxil approved, investigational unknown target Details Buspirone approved, investigational unknown target antagonist Details Flupentixol approved, investigational, withdrawn unknown target antagonist Details Dihydroergotamine approved, investigational unknown target agonist Details Cariprazine approved, investigational yes target partial agonist Details Brexpiprazole approved, investigational unknown target partial agonist Details Spiperone investigational yes target antagonist Details Azaperone investigational, vet_approved yes target inhibitor Details Fingolimod approved, investigational yes target antagonist Details Dordaviprone investigational yes target antagonist Details Trazpiroben investigational yes target inhibitor Details