D(3) dopamine receptor
Details
- Name
- D(3) dopamine receptor
- Synonyms
- Dopamine D3 receptor
- Gene Name
- DRD3
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0001159|D(3) dopamine receptor MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
- Number of residues
- 400
- Molecular Weight
- 44224.335
- Theoretical pI
- 9.07
- GO Classification
- Functionsdopamine binding / dopamine neurotransmitter receptor activity, coupled via Gi/Go / drug binding / G-protein coupled amine receptor activityProcessesacid secretion / adenylate cyclase-activating dopamine receptor signaling pathway / adenylate cyclase-inhibiting dopamine receptor signaling pathway / arachidonic acid secretion / behavioral response to cocaine / cellular calcium ion homeostasis / circadian regulation of gene expression / dopamine metabolic process / G-protein coupled receptor internalization / G-protein coupled receptor signaling pathway / gastric emptying / learning / learning or memory / locomotory behavior / musculoskeletal movement, spinal reflex action / negative regulation of adenylate cyclase activity / negative regulation of blood pressure / negative regulation of dopamine receptor signaling pathway / negative regulation of oligodendrocyte differentiation / negative regulation of protein kinase B signaling / negative regulation of protein secretion / negative regulation of sodium / negative regulation of transcription from RNA polymerase II promoter / positive regulation of cell proliferation / positive regulation of cytokinesis / positive regulation of dopamine receptor signaling pathway / positive regulation of mitotic nuclear division / positive regulation of renal sodium excretion / positive regulation of transcription from RNA polymerase II promoter / prepulse inhibition / regulation of blood volume by renin-angiotensin / regulation of cAMP metabolic process / regulation of circadian sleep/wake cycle, sleep / regulation of dopamine secretion / regulation of dopamine uptake involved in synaptic transmission / regulation of lipid metabolic process / regulation of locomotion involved in locomotory behavior / regulation of multicellular organism growth / response to amphetamine / response to cocaine / response to drug / response to histamine / response to morphine / sensory perception of chemical stimulus / social behavior / synaptic transmission / synaptic transmission, dopaminergic / visual learningComponentsapical part of cell / cell projection / endocytic vesicle / integral component of plasma membrane / plasma membrane
- General Function
- G-protein coupled amine receptor activity
- Specific Function
- Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase. Promotes cell proliferation.
- Pfam Domain Function
- 7tm_1 (PF00001)
- Transmembrane Regions
- 33-55 66-88 105-126 150-170 188-212 330-351 367-388
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0021269|D(3) dopamine receptor (DRD3) ATGGCATCTCTGAGCCAGCTGAGTGGCCACCTGAACTACACCTGTGGGGCAGAGAACTCC ACAGGTGCCAGCCAGGCCCGCCCACATGCCTACTATGCCCTCTCCTACTGCGCGCTCATC CTGGCCATCGTCTTCGGCAATGGCCTGGTGTGCATGGCTGTGCTGAAGGAGCGGGCCCTG CAGACTACCACCAACTACTTAGTAGTGAGCCTGGCTGTGGCAGACTTGCTGGTGGCCACC TTGGTGATGCCCTGGGTGGTATACCTGGAGGTGACAGGTGGAGTCTGGAATTTCAGCCGC ATTTGCTGTGATGTTTTTGTCACCCTGGATGTCATGATGTGTACAGCCAGCATCCTTAAT CTCTGTGCCATCAGCATAGACAGGTACACTGCAGTGGTCATGCCCGTTCACTACCAGCAT GGCACGGGACAGAGCTCCTGTCGGCGCGTGGCCCTCATGATCACGGCCGTCTGGGTACTG GCCTTTGCTGTGTCCTGCCCTCTTCTGTTTGGCTTTAATACCACAGGGGACCCCACTGTC TGCTCCATCTCCAACCCTGATTTTGTCATCTACTCTTCAGTGGTGTCCTTCTACCTGCCC TTTGGAGTGACTGTCCTTGTCTATGCCAGAATCTATGTGGTGCTGAAACAAAGGAGACGG AAAAGGATCCTCACTCGACAGAACAGTCAGTGCAACAGTGTCAGGCCTGGCTTCCCCCAA CAAACCCTCTCTCCTGACCCGGCACATCTGGAGCTGAAGCGTTACTACAGCATCTGCCAG GACACTGCCTTGGGTGGACCAGGCTTCCAAGAAAGAGGAGGAGAGTTGAAAAGAGAGGAG AAGACTCGGAATTCCCTGAGTCCCACCATAGCGCCCAAGCTCAGCTTAGAAGTTCGAAAA CTCAGCAATGGCAGATTATCGACATCTTTGAAGCTGGGGCCCCTGCAACCTCGGGGAGTG CCACTTCGGGAGAAGAAGGCAACCCAAATGGTGGCCATTGTGCTTGGGGCCTTCATTGTC TGCTGGCTGCCCTTCTTCTTGACCCATGTTCTCAATACCCACTGCCAGACATGCCACGTG TCCCCAGAGCTTTACAGTGCCACGACATGGCTGGGCTACGTGAATAGCGCCCTCAACCCT GTGATCTATACCACCTTCAATATCGAGTTCCGGAAAGCCTTCCTCAAGATCCTGTCTTGC TGA
- Chromosome Location
- 3
- Locus
- 3q13.3
- External Identifiers
Resource Link UniProtKB ID P35462 UniProtKB Entry Name DRD3_HUMAN GenBank Protein ID 927342 GenBank Gene ID U32499 GenAtlas ID DRD3 HGNC ID HGNC:3024 - General References
- Giros B, Martres MP, Sokoloff P, Schwartz JC: [Gene cloning of human dopaminergic D3 receptor and identification of its chromosome]. C R Acad Sci III. 1990;311(13):501-8. [Article]
- Schmauss C, Haroutunian V, Davis KL, Davidson M: Selective loss of dopamine D3-type receptor mRNA expression in parietal and motor cortices of patients with chronic schizophrenia. Proc Natl Acad Sci U S A. 1993 Oct 1;90(19):8942-6. [Article]
- Liu K, Bergson C, Levenson R, Schmauss C: On the origin of mRNA encoding the truncated dopamine D3-type receptor D3nf and detection of D3nf-like immunoreactivity in human brain. J Biol Chem. 1994 Nov 18;269(46):29220-6. [Article]
- Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Basile M, Lin R, Kabbani N, Karpa K, Kilimann M, Simpson I, Kester M: Paralemmin interacts with D3 dopamine receptors: implications for membrane localization and cAMP signaling. Arch Biochem Biophys. 2006 Feb 1;446(1):60-8. Epub 2005 Dec 1. [Article]
- Villar VA, Jones JE, Armando I, Palmes-Saloma C, Yu P, Pascua AM, Keever L, Arnaldo FB, Wang Z, Luo Y, Felder RA, Jose PA: G protein-coupled receptor kinase 4 (GRK4) regulates the phosphorylation and function of the dopamine D3 receptor. J Biol Chem. 2009 Aug 7;284(32):21425-34. doi: 10.1074/jbc.M109.003665. Epub 2009 Jun 11. [Article]
- Chien EY, Liu W, Zhao Q, Katritch V, Han GW, Hanson MA, Shi L, Newman AH, Javitch JA, Cherezov V, Stevens RC: Structure of the human dopamine D3 receptor in complex with a D2/D3 selective antagonist. Science. 2010 Nov 19;330(6007):1091-5. doi: 10.1126/science.1197410. [Article]
- Chen CH, Liu MY, Wei FC, Koong FJ, Hwu HG, Hsiao KJ: Further evidence of no association between Ser9Gly polymorphism of dopamine D3 receptor gene and schizophrenia. Am J Med Genet. 1997 Feb 21;74(1):40-3. [Article]
- Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES: Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. 1999 Jul;22(3):231-8. [Article]
- Lucotte G, Lagarde JP, Funalot B, Sokoloff P: Linkage with the Ser9Gly DRD3 polymorphism in essential tremor families. Clin Genet. 2006 May;69(5):437-40. [Article]
- Jeanneteau F, Funalot B, Jankovic J, Deng H, Lagarde JP, Lucotte G, Sokoloff P: A functional variant of the dopamine D3 receptor is associated with risk and age-at-onset of essential tremor. Proc Natl Acad Sci U S A. 2006 Jul 11;103(28):10753-8. Epub 2006 Jun 29. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB00246 Ziprasidone approved unknown antagonist Details DB00268 Ropinirole approved, investigational yes agonist Details DB00413 Pramipexole approved, investigational yes agonist Details DB01403 Methotrimeprazine approved, investigational unknown antagonist Details DB01239 Chlorprothixene approved, experimental, investigational, withdrawn yes antagonist Details DB00714 Apomorphine approved, investigational yes agonist Details DB00334 Olanzapine approved, investigational unknown antagonist Details DB12061 Pardoprunox investigational unknown Details DB05766 Norclozapine investigational unknown Details DB06216 Asenapine approved unknown antagonist Details DB06477 Sumanirole investigational unknown Details DB06288 Amisulpride approved, investigational yes antagonist Details DB01186 Pergolide approved, investigational, vet_approved, withdrawn yes agonist Details DB01200 Bromocriptine approved, investigational, withdrawn yes agonist Details DB00589 Lisuride approved, investigational yes agonist Details DB00248 Cabergoline approved unknown agonist Details DB05271 Rotigotine approved yes agonist Details DB00502 Haloperidol approved unknown inverse agonist Details DB01267 Paliperidone approved yes antagonist Details DB00363 Clozapine approved unknown antagonist Details DB01238 Aripiprazole approved, investigational unknown antagonistpartial agonist Details DB01224 Quetiapine approved unknown ligand Details DB00409 Remoxipride approved, withdrawn unknown antagonist Details DB01392 Yohimbine approved, investigational, vet_approved unknown antagonist Details DB00391 Sulpiride approved, investigational unknown antagonist Details DB00988 Dopamine approved yes agonist Details DB01235 Levodopa approved yes agonist Details DB01100 Pimozide approved yes antagonist Details DB01184 Domperidone approved, investigational, vet_approved yes antagonist Details DB04946 Iloperidone approved unknown antagonist Details DB00477 Chlorpromazine approved, investigational, vet_approved unknown inhibitor Details DB00408 Loxapine approved unknown binder Details DB00543 Amoxapine approved unknown antagonist Details DB06148 Mianserin approved, investigational unknown binder Details DB09014 Captodiame experimental yes agonist Details DB09207 AS-8112 experimental unknown antagonist Details DB13025 Tiapride investigational yes blocker Details DB12478 Piribedil investigational unknown Details DB06454 Sarizotan investigational unknown ligand Details DB09223 Blonanserin investigational yes antagonist Details DB09286 Pipamperone investigational unknown Details DB11274 Dihydro-alpha-ergocryptine approved yes partial agonist Details DB09289 Tianeptine investigational unknown agonist Details DB14185 Aripiprazole lauroxil approved, investigational unknown Details DB00490 Buspirone approved, investigational unknown antagonist Details DB00875 Flupentixol approved, investigational, withdrawn unknown antagonist Details DB00320 Dihydroergotamine approved, investigational unknown agonist Details DB06016 Cariprazine approved, investigational unknown partial agonist Details DB13345 Dihydroergocristine approved, experimental yes antagonistagonist Details DB01049 Ergoloid mesylate approved yes antagonistagonist Details DB11275 Epicriptine approved yes agonist Details DB08804 Nandrolone decanoate approved, illicit unknown modulator Details