Nuclear receptor subfamily 1 group I member 2
Details
- Name
- Nuclear receptor subfamily 1 group I member 2
- Kind
- protein
- Synonyms
- Orphan nuclear receptor PAR1
- Orphan nuclear receptor PXR
- Pregnane X receptor
- PXR
- Steroid and xenobiotic receptor
- SXR
- Gene Name
- NR1I2
- UniProtKB Entry
- O75469Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0001903|Nuclear receptor subfamily 1 group I member 2 MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEG CKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEE RRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSS GCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLL PHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWE CGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHR VVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPF ATPLMQELFGITGS
- Number of residues
- 434
- Molecular Weight
- 49761.245
- Theoretical pI
- 8.44
- GO Classification
- Functionszinc ion bindingProcessessignal transduction / steroid metabolic process / xenobiotic metabolic process / xenobiotic transportComponentsnucleoplasm
- General Function
- Nuclear receptor that binds and is activated by variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds. Activated by the antibiotic rifampicin and various plant metabolites, such as hyperforin, guggulipid, colupulone, and isoflavones. Response to specific ligands is species-specific. Activated by naturally occurring steroids, such as pregnenolone and progesterone. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes
- Specific Function
- Dna-binding transcription activator activity, rna polymerase ii-specific
- Pfam Domain Function
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Nucleus
- Gene sequence
>lcl|BSEQ0010672|Nuclear receptor subfamily 1 group I member 2 (NR1I2) CTGGAGGTGAGACCCAAAGAAAGCTGGAACCATGCTGACTTTGTACACTGTGAGGACACA GAGTCTGTTCCTGGAAAGCCCAGTGTCAACGCAGATGAGGAAGTCGGAGGTCCCCAAATC TGCCGTGTATGTGGGGACAAGGCCACTGGCTATCACTTCAATGTCATGACATGTGAAGGA TGCAAGGGCTTTTTCAGGAGGGCCATGAAACGCAACGCCCGGCTGAGGTGCCCCTTCCGG AAGGGCGCCTGCGAGATCACCCGGAAGACCCGGCGACAGTGCCAGGCCTGCCGCCTGCGC AAGTGCCTGGAGAGCGGCATGAAGAAGGAGATGATCATGTCCGACGAGGCCGTGGAGGAG AGGCGGGCCTTGATCAAGCGGAAGAAAAGTGAACGGACAGGGACTCAGCCACTGGGAGTG CAGGGGCTGACAGAGGAGCAGCGGATGATGATCAGGGAGCTGATGGACGCTCAGATGAAA ACCTTTGACACTACCTTCTCCCATTTCAAGAATTTCCGGCTGCCAGGGGTGCTTAGCAGT GGCTGCGAGTTGCCAGAGTCTCTGCAGGCCCCATCGAGGGAAGAAGCTGCCAAGTGGAGC CAGGTCCGGAAAGATCTGTGCTCTTTGAAGGTCTCTCTGCAGCTGCGGGGGGAGGATGGC AGTGTCTGGAACTACAAACCCCCAGCCGACAGTGGCGGGAAAGAGATCTTCTCCCTGCTG CCCCACATGGCTGACATGTCAACCTACATGTTCAAAGGCATCATCAGCTTTGCCAAAGTC ATCTCCTACTTCAGGGACTTGCCCATCGAGGACCAGATCTCCCTGCTGAAGGGGGCCGCT TTCGAGCTGTGTCAACTGAGATTCAACACAGTGTTCAACGCGGAGACTGGAACCTGGGAG TGTGGCCGGCTGTCCTACTGCTTGGAAGACACTGCAGGTGGCTTCCAGCAACTTCTACTG GAGCCCATGCTGAAATTCCACTACATGCTGAAGAAGCTGCAGCTGCATGAGGAGGAGTAT GTGCTGATGCAGGCCATCTCCCTCTTCTCCCCAGACCGCCCAGGTGTGCTGCAGCACCGC GTGGTGGACCAGCTGCAGGAGCAATTCGCCATTACTCTGAAGTCCTACATTGAATGCAAT CGGCCCCAGCCTGCTCATAGGTTCTTGTTCCTGAAGATCATGGCTATGCTCACCGAGCTC CGCAGCATCAATGCTCAGCACACCCAGCGGCTGCTGCGCATCCAGGACATACACCCCTTT GCTACGCCCCTCATGCAGGAGTTGTTCGGCATCACAGGTAGCTGA
- Chromosome Location
- 3
- Locus
- 3q13.33
- External Identifiers
Resource Link UniProtKB ID O75469 UniProtKB Entry Name NR1I2_HUMAN GenBank Protein ID 3511138 GenBank Gene ID AF061056 GeneCard ID NR1I2 GenAtlas ID NR1I2 HGNC ID HGNC:7968 PDB ID(s) 1ILG, 1ILH, 1M13, 1NRL, 1SKX, 2O9I, 2QNV, 3CTB, 3HVL, 3R8D, 4J5W, 4J5X, 4NY9, 4S0S, 4S0T, 4X1F, 4X1G, 4XAO, 4XHD, 5A86, 5X0R, 6BNS, 6DUP, 6HJ2, 6HTY, 6NX1, 6P2B, 6S41, 6TFI, 6XP9, 7AX8, 7AX9, 7AXA, 7AXB, 7AXC, 7AXD, 7AXE, 7AXF, 7AXG, 7AXH, 7AXI, 7AXJ, 7AXK, 7AXL, 7N2A, 7RIO, 7RIU, 7RIV, 7YFK, 8CCT, 8CF9, 8CH8, 8E3N, 8EQZ, 8F5Y, 8FPE, 8SZV KEGG ID hsa:8856 IUPHAR/Guide To Pharmacology ID 606 NCBI Gene ID 8856 - General References
- Blumberg B, Sabbagh W Jr, Juguilon H, Bolado J Jr, van Meter CM, Ong ES, Evans RM: SXR, a novel steroid and xenobiotic-sensing nuclear receptor. Genes Dev. 1998 Oct 15;12(20):3195-205. [Article]
- Lehmann JM, McKee DD, Watson MA, Willson TM, Moore JT, Kliewer SA: The human orphan nuclear receptor PXR is activated by compounds that regulate CYP3A4 gene expression and cause drug interactions. J Clin Invest. 1998 Sep 1;102(5):1016-23. [Article]
- Bertilsson G, Heidrich J, Svensson K, Asman M, Jendeberg L, Sydow-Backman M, Ohlsson R, Postlind H, Blomquist P, Berkenstam A: Identification of a human nuclear receptor defines a new signaling pathway for CYP3A induction. Proc Natl Acad Sci U S A. 1998 Oct 13;95(21):12208-13. [Article]
- Zhang J, Kuehl P, Green ED, Touchman JW, Watkins PB, Daly A, Hall SD, Maurel P, Relling M, Brimer C, Yasuda K, Wrighton SA, Hancock M, Kim RB, Strom S, Thummel K, Russell CG, Hudson JR Jr, Schuetz EG, Boguski MS: The human pregnane X receptor: genomic structure and identification and functional characterization of natural allelic variants. Pharmacogenetics. 2001 Oct;11(7):555-72. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Geick A, Eichelbaum M, Burk O: Nuclear receptor response elements mediate induction of intestinal MDR1 by rifampin. J Biol Chem. 2001 May 4;276(18):14581-7. Epub 2001 Jan 31. [Article]
- Kawana K, Ikuta T, Kobayashi Y, Gotoh O, Takeda K, Kawajiri K: Molecular mechanism of nuclear translocation of an orphan nuclear receptor, SXR. Mol Pharmacol. 2003 Mar;63(3):524-31. [Article]
- Li Y, Ross-Viola JS, Shay NF, Moore DD, Ricketts ML: Human CYP3A4 and murine Cyp3A11 are regulated by equol and genistein via the pregnane X receptor in a species-specific manner. J Nutr. 2009 May;139(5):898-904. doi: 10.3945/jn.108.103572. Epub 2009 Mar 18. [Article]
- Watkins RE, Wisely GB, Moore LB, Collins JL, Lambert MH, Williams SP, Willson TM, Kliewer SA, Redinbo MR: The human nuclear xenobiotic receptor PXR: structural determinants of directed promiscuity. Science. 2001 Jun 22;292(5525):2329-33. Epub 2001 Jun 14. [Article]
- Watkins RE, Maglich JM, Moore LB, Wisely GB, Noble SM, Davis-Searles PR, Lambert MH, Kliewer SA, Redinbo MR: 2.1 A crystal structure of human PXR in complex with the St. John's wort compound hyperforin. Biochemistry. 2003 Feb 18;42(6):1430-8. [Article]
- Watkins RE, Davis-Searles PR, Lambert MH, Redinbo MR: Coactivator binding promotes the specific interaction between ligand and the pregnane X receptor. J Mol Biol. 2003 Aug 22;331(4):815-28. [Article]
- Chrencik JE, Orans J, Moore LB, Xue Y, Peng L, Collins JL, Wisely GB, Lambert MH, Kliewer SA, Redinbo MR: Structural disorder in the complex of human pregnane X receptor and the macrolide antibiotic rifampicin. Mol Endocrinol. 2005 May;19(5):1125-34. Epub 2005 Feb 10. [Article]
- Xue Y, Chao E, Zuercher WJ, Willson TM, Collins JL, Redinbo MR: Crystal structure of the PXR-T1317 complex provides a scaffold to examine the potential for receptor antagonism. Bioorg Med Chem. 2007 Mar 1;15(5):2156-66. Epub 2006 Dec 20. [Article]
- Teotico DG, Bischof JJ, Peng L, Kliewer SA, Redinbo MR: Structural basis of human pregnane X receptor activation by the hops constituent colupulone. Mol Pharmacol. 2008 Dec;74(6):1512-20. doi: 10.1124/mol.108.050732. Epub 2008 Sep 2. [Article]
- Koyano S, Kurose K, Ozawa S, Saeki M, Nakajima Y, Hasegawa R, Komamura K, Ueno K, Kamakura S, Nakajima T, Saito H, Kimura H, Goto Y, Saitoh O, Katoh M, Ohnuma T, Kawai M, Sugai K, Ohtsuki T, Suzuki C, Minami N, Saito Y, Sawada J: Eleven novel single nucleotide polymorphisms in the NR1I2 (PXR) gene, four of which induce non-synonymous amino acid alterations. Drug Metab Pharmacokinet. 2002;17(6):561-5. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Estradiol approved, investigational, vet_approved unknown target binder Details Ethinylestradiol approved unknown target agonist Details Hyperforin nutraceutical unknown target Details SR12813 experimental unknown target Details Vitamin E approved, nutraceutical, vet_approved unknown target Details Rifampin approved unknown target agonist Details Rifaximin approved, investigational no target agonist Details TO-901317 experimental unknown target Details Erlotinib approved, investigational yes target agonist Details Rilpivirine approved unknown target agonist Details Paclitaxel approved, vet_approved unknown target inducer Details Docetaxel approved, investigational unknown target binder Details Prasterone approved, investigational, nutraceutical unknown target activator Details Myrrh approved unknown target partial agonist Details Carbamazepine approved, investigational unknown target activator Details Sulfinpyrazone approved unknown target activator Details Phenobarbital approved, investigational unknown target activator Details Phenytoin approved, vet_approved unknown target Details Ritonavir approved, investigational unknown target activator Details Clotrimazole approved, vet_approved unknown target activator Details Ethotoin approved unknown target activator Details Mephenytoin approved, investigational, withdrawn unknown target activator Details Methylphenobarbital approved unknown target activator Details Pentobarbital approved, investigational, vet_approved unknown target activator Details Troleandomycin approved unknown target activator Details Afimoxifene investigational unknown target Details Dexamethasone approved, investigational, vet_approved unknown target agonist Details Diethylstilbestrol approved, investigational, withdrawn unknown target Details Genistein investigational unknown target Details Lindane approved, withdrawn unknown target Details Mifepristone approved, investigational unknown target Details Pregnenolone approved, experimental unknown target Details Spironolactone approved unknown target agonist Details Triclosan approved, investigational unknown target Details Tamoxifen approved unknown target Details Chenodeoxycholic acid approved unknown target Details Econazole approved unknown target partial agonist Details Miconazole approved, investigational, vet_approved unknown target partial agonist Details Oxiconazole approved unknown target partial agonist Details Ketoconazole approved, investigational unknown target antagonist Details Cyclophosphamide approved, investigational unknown target Details Flutamide approved, investigational unknown target Details Ifosfamide approved unknown target Details Bezafibrate approved, investigational unknown target partial agonist Details Clonazepam approved, illicit unknown target partial agonist Details Fenofibrate approved unknown target partial agonist Details Warfarin approved unknown target Details Hexestrol withdrawn unknown target Details Phenolphthalein approved, withdrawn unknown target Details Resveratrol investigational unknown target Details Permethrin approved, investigational unknown target Details Pyrethrum extract approved unknown target Details Nifedipine approved unknown target agonist Details Piperine investigational unknown target Details Quercetin experimental, investigational unknown target activator Details Estradiol acetate approved, investigational, vet_approved unknown target Details Estradiol benzoate approved, investigational, vet_approved unknown target Details Estradiol cypionate approved, investigational, vet_approved unknown target Details Estradiol dienanthate approved, investigational, vet_approved unknown target Details Estradiol valerate approved, investigational, vet_approved unknown target Details Fenofibric acid approved unknown target partial agonist Details alpha-Tocopherol succinate approved, nutraceutical, vet_approved unknown target Details D-alpha-Tocopherol acetate approved, nutraceutical, vet_approved unknown target Details Dovitinib investigational unknown target suppressor Details Dexamethasone acetate approved, investigational, vet_approved unknown target agonist Details