Alpha-1-acid glycoprotein 1
Details
- Name
- Alpha-1-acid glycoprotein 1
- Kind
- protein
- Synonyms
- AGP 1
- AGP1
- OMD 1
- Orosomucoid-1
- Gene Name
- ORM1
- UniProtKB Entry
- P02763Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0055618|Alpha-1-acid glycoprotein 1 MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQ EIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLL ILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKK DKCEPLEKQHEKERKQEEGES
- Number of residues
- 201
- Molecular Weight
- 23539.43
- Theoretical pI
- 4.66
- GO Classification
- Processespositive regulation of interleukin-1 beta production / positive regulation of interleukin-1 production / positive regulation of tumor necrosis factor productionComponentscollagen-containing extracellular matrix / platelet alpha granule lumen / specific granule lumen / tertiary granule lumen
- General Function
- Functions as a transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain. Also binds synthetic drugs and influences their distribution and availability in the body. Appears to function in modulating the activity of the immune system during the acute-phase reaction
- Specific Function
- Not Available
- Pfam Domain Function
- Lipocalin (PF00061)
- Signal Regions
- 1-18
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0010649|Alpha-1-acid glycoprotein 1 (ORM1) ATGGCGCTGTCCTGGGTTCTTACAGTCCTGAGCCTCCTACCTCTGCTGGAAGCCCAGATC CCATTGTGTGCCAACCTAGTACCGGTGCCCATCACCAACGCCACCCTGGACCGGATCACT GGCAAGTGGTTTTATATCGCATCGGCCTTTCGAAACGAGGAGTACAATAAGTCGGTTCAG GAGATCCAAGCAACCTTCTTTTACTTCACCCCCAACAAGACAGAGGACACGATCTTTCTC AGAGAGTACCAGACCCGACAGGACCAGTGCATCTATAACACCACCTACCTGAATGTCCAG CGGGAAAATGGGACCATCTCCAGATACGTGGGAGGCCAAGAGCATTTCGCTCACTTGCTG ATCCTCAGGGACACCAAGACCTACATGCTTGCTTTTGACGTGAACGATGAGAAGAACTGG GGGCTGTCTGTCTATGCTGACAAGCCAGAGACGACCAAGGAGCAACTGGGAGAGTTCTAC GAAGCTCTCGACTGCTTGCGCATTCCCAAGTCAGATGTCGTGTACACCGATTGGAAAAAG GATAAGTGTGAGCCACTGGAGAAGCAGCACGAGAAGGAGAGGAAACAGGAGGAGGGGGAA TCCTAG
- Chromosome Location
- 9
- Locus
- 9q32
- External Identifiers
Resource Link UniProtKB ID P02763 UniProtKB Entry Name A1AG1_HUMAN GenBank Protein ID 757907 GenBank Gene ID X02544 GeneCard ID ORM1 GenAtlas ID ORM1 HGNC ID HGNC:8498 PDB ID(s) 3KQ0 KEGG ID hsa:5004 NCBI Gene ID 5004 - General References
- Dente L, Pizza MG, Metspalu A, Cortese R: Structure and expression of the genes coding for human alpha 1-acid glycoprotein. EMBO J. 1987 Aug;6(8):2289-96. [Article]
- Board PG, Jones IM, Bentley AK: Molecular cloning and nucleotide sequence of human alpha 1 acid glycoprotein cDNA. Gene. 1986;44(1):127-31. [Article]
- Dente L, Ciliberto G, Cortese R: Structure of the human alpha 1-acid glycoprotein gene: sequence homology with other human acute phase protein genes. Nucleic Acids Res. 1985 Jun 11;13(11):3941-52. [Article]
- Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
- Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Schmid K, Kaufmann H, Isemura S, Bauer F, Emura J, Motoyama T, Ishiguro M, Nanno S: Structure of 1 -acid glycoprotein. The complete amino acid sequence, multiple amino acid substitutions, and homology with the immunoglobulins. Biochemistry. 1973 Jul 3;12(14):2711-24. [Article]
- Ikenaka T, Ishiguro M, Emura J, Kaufmann H, Isemura S, Bauer W, Schmid K: Isolation and partial characterization of the cyanogen bromide fragments of 1 -acid glycoprotein and the elucidation of the amino acid sequence of the carboxyl-terminal cyanogen bromide fragment. Biochemistry. 1972 Sep 26;11(20):3817-29. [Article]
- Schmid K, Burgi W, Collins JH, Nanno S: The disulfide bonds of alpha1-acid glycoprotein. Biochemistry. 1974 Jun 18;13(13):2694-7. [Article]
- Treuheit MJ, Costello CE, Halsall HB: Analysis of the five glycosylation sites of human alpha 1-acid glycoprotein. Biochem J. 1992 Apr 1;283 ( Pt 1):105-12. [Article]
- Zhang H, Li XJ, Martin DB, Aebersold R: Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry. Nat Biotechnol. 2003 Jun;21(6):660-6. Epub 2003 May 18. [Article]
- Hagglund P, Bunkenborg J, Elortza F, Jensen ON, Roepstorff P: A new strategy for identification of N-glycosylated proteins and unambiguous assignment of their glycosylation sites using HILIC enrichment and partial deglycosylation. J Proteome Res. 2004 May-Jun;3(3):556-66. [Article]
- Kristiansen TZ, Bunkenborg J, Gronborg M, Molina H, Thuluvath PJ, Argani P, Goggins MG, Maitra A, Pandey A: A proteomic analysis of human bile. Mol Cell Proteomics. 2004 Jul;3(7):715-28. Epub 2004 Apr 14. [Article]
- Bunkenborg J, Pilch BJ, Podtelejnikov AV, Wisniewski JR: Screening for N-glycosylated proteins by liquid chromatography mass spectrometry. Proteomics. 2004 Feb;4(2):454-65. [Article]
- Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [Article]
- Fitos I, Visy J, Zsila F, Mady G, Simonyi M: Selective binding of imatinib to the genetic variants of human alpha1-acid glycoprotein. Biochim Biophys Acta. 2006 Nov;1760(11):1704-12. Epub 2006 Aug 25. [Article]
- Ramachandran P, Boontheung P, Xie Y, Sondej M, Wong DT, Loo JA: Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry. J Proteome Res. 2006 Jun;5(6):1493-503. [Article]
- Zsila F, Iwao Y: The drug binding site of human alpha1-acid glycoprotein: insight from induced circular dichroism and electronic absorption spectra. Biochim Biophys Acta. 2007 May;1770(5):797-809. Epub 2007 Jan 28. [Article]
- Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [Article]
- Nilsson J, Ruetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G: Enrichment of glycopeptides for glycan structure and attachment site identification. Nat Methods. 2009 Nov;6(11):809-11. doi: 10.1038/nmeth.1392. Epub 2009 Oct 18. [Article]
- Halim A, Nilsson J, Ruetschi U, Hesse C, Larson G: Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD. Mol Cell Proteomics. 2012 Apr;11(4):M111.013649. doi: 10.1074/mcp.M111.013649. Epub 2011 Dec 14. [Article]
- Schonfeld DL, Ravelli RB, Mueller U, Skerra A: The 1.8-A crystal structure of alpha1-acid glycoprotein (Orosomucoid) solved by UV RIP reveals the broad drug-binding activity of this human plasma lipocalin. J Mol Biol. 2008 Dec 12;384(2):393-405. doi: 10.1016/j.jmb.2008.09.020. Epub 2008 Sep 16. [Article]
- Yuasa I, Umetsu K, Vogt U, Nakamura H, Nanba E, Tamaki N, Irizawa Y: Human orosomucoid polymorphism: molecular basis of the three common ORM1 alleles, ORM1*F1, ORM1*F2, and ORM1*S. Hum Genet. 1997 Mar;99(3):393-8. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Disopyramide approved no carrier other/unknown Details Tamsulosin approved, investigational no carrier Details Quinidine approved, investigational unknown carrier binder Details Phenprocoumon approved, investigational no carrier Details Penbutolol approved, investigational unknown carrier other/unknown Details Aprindine experimental unknown carrier Details Acenocoumarol approved, investigational no carrier Details Warfarin approved no carrier Details Alfentanil approved, illicit unknown carrier Details Nortriptyline approved no carrier binder Details Amitriptyline approved no carrier binder Details Saquinavir approved, investigational unknown carrier Details Olanzapine approved, investigational no carrier binder Details Amoxapine approved no carrier Details Prazosin approved no carrier substrate Details Propranolol approved, investigational no carrier Details Imipramine approved no carrier Details Desipramine approved, investigational no carrier Details Nomifensine approved, withdrawn no carrier Details Bupropion approved no carrier antagonist Details Maprotiline approved, investigational no carrier Details Ajmaline approved, experimental unknown carrier Details Meperidine approved unknown carrier binder Details Nateglinide approved, investigational unknown carrier Details Ulipristal approved no carrier substrate Details Vandetanib approved unknown carrier binder Details Telaprevir approved, withdrawn no carrier substrate Details Abiraterone approved unknown carrier binder Details Vemurafenib approved unknown carrier substrate Details Vismodegib approved, investigational unknown carrier binder Details Mirabegron approved no carrier binder Details Ivacaftor approved no carrier carrier Details Pitavastatin approved unknown carrier substrate Details Canagliflozin approved unknown carrier substrate Details Erlotinib approved, investigational unknown carrier substrate Details Fluoxetine approved, vet_approved unknown carrier substrate Details Gefitinib approved, investigational unknown carrier substrate Details Imatinib approved no carrier binder Details Tacrolimus approved, investigational unknown carrier substrate Details Riociguat approved unknown carrier substrate Details Grazoprevir approved no carrier substrate Details Topiroxostat experimental unknown carrier binder Details Amsacrine approved, investigational unknown target Details Progesterone approved, vet_approved unknown target binder Details Dipyridamole approved unknown target Details Lidocaine approved, vet_approved unknown target Details Lacidipine approved, investigational unknown carrier binder Details Arotinolol investigational no carrier substrate Details Aranidipine experimental no carrier binder Details Butamben approved, withdrawn no carrier substrate Details Delamanid approved, investigational unknown carrier substrate Details Ranolazine approved, investigational no carrier binder Details Doxepin approved, investigational no carrier binder Details Dutasteride approved, investigational no carrier binder Details Diltiazem approved, investigational no carrier binder Details Raloxifene approved, investigational no carrier binder Details Buspirone approved, investigational unknown carrier binder Details Pexidartinib approved, investigational unknown carrier binder Details Methadone approved no carrier Details Metoclopramide approved, investigational unknown carrier binder Details Oxybutynin approved, investigational unknown carrier binder Details Verapamil approved unknown carrier substrate Details Clindamycin approved, vet_approved unknown carrier substrate Details Ziprasidone approved unknown carrier Details Darunavir approved unknown carrier substrate Details Lopinavir approved unknown carrier substrate Details Ritonavir approved, investigational unknown carrier substrate Details Pitolisant approved, investigational no carrier binder Details Risperidone approved, investigational unknown carrier binder Details Lurbinectedin approved, investigational unknown carrier binder Details Relugolix approved, investigational unknown carrier binder Details Tepotinib approved, investigational unknown carrier binder Details Alfuzosin approved, investigational unknown carrier binder Details Temozolomide approved, investigational no carrier binder Details Avanafil approved unknown carrier binder Details Daptomycin approved, investigational no carrier binder Details Estetrol approved, investigational unknown carrier binder Details Lincomycin approved, vet_approved no carrier binder Details Belumosudil approved, investigational no carrier binder Details Sirolimus approved, investigational no carrier binder Details Maribavir approved, investigational no carrier binder Details Olaparib approved unknown carrier binder Details Nelfinavir approved no carrier binder Details Ropivacaine approved no carrier binder Details Atropine approved, vet_approved unknown carrier binder Details Futibatinib approved, investigational no carrier binder Details Vonoprazan approved, investigational unknown carrier binder Details Cobimetinib approved, investigational no carrier binder Details Clozapine approved no carrier binder Details Clobazam approved, illicit no carrier binder Details Midazolam approved, illicit no carrier binder Details Brexpiprazole approved, investigational no carrier substrate Details Fluticasone furoate approved no carrier binder Details Umeclidinium approved unknown carrier binder Details Melphalan approved unknown carrier binder Details Bedaquiline approved no carrier binder Details Iptacopan approved, investigational yes carrier binder Details