Solute carrier organic anion transporter family member 2B1
Details
- Name
- Solute carrier organic anion transporter family member 2B1
- Kind
- protein
- Synonyms
- KIAA0880
- OATP-B
- OATP-RP2
- OATP2B1
- OATPB
- OATPRP2
- Organic anion transporter B
- Organic anion transporter polypeptide-related protein 2
- Organic anion transporting polypeptide 2B1
- SLC21A9
- Solute carrier family 21 member 9
- Gene Name
- SLCO2B1
- UniProtKB Entry
- O94956Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0055329|Solute carrier organic anion transporter family member 2B1 MGPRIGPAGEVPQVPDKETKATMGTENTPGGKASPDPQDVRPSVFHNIKLFVLCHSLLQL AQLMISGYLKSSISTVEKRFGLSSQTSGLLASFNEVGNTALIVFVSYFGSRVHRPRMIGY GAILVALAGLLMTLPHFISEPYRYDNTSPEDMPQDFKASLCLPTTSAPASAPSNGNCSSY TETQHLSVVGIMFVAQTLLGVGGVPIQPFGISYIDDFAHNSNSPLYLGILFAVTMMGPGL AFGLGSLMLRLYVDINQMPEGGISLTIKDPRWVGAWWLGFLIAAGAVALAAIPYFFFPKE MPKEKRELQFRRKVLAVTDSPARKGKDSPSKQSPGESTKKQDGLVQIAPNLTVIQFIKVF PRVLLQTLRHPIFLLVVLSQVCLSSMAAGMATFLPKFLERQFSITASYANLLIGCLSFPS VIVGIVVGGVLVKRLHLGPVGCGALCLLGMLLCLFFSLPLFFIGCSSHQIAGITHQTSAH PGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCS CVVEGNPVLAGSCDSTCSHLVVPFLLLVSLGSALACLTHTPSFMLILRGVKKEDKTLAVG IQFMFLRILAWMPSPVIHGSAIDTTCVHWALSCGRRAVCRYYNNDLLRNRFIGLQFFFKT GSVICFALVLAVLRQQDKEARTKESRSSPAVEQQLLVSGPGKKPEDSRV
- Number of residues
- 709
- Molecular Weight
- 76697.93
- Theoretical pI
- 8.39
- GO Classification
- Functionsprostaglandin transmembrane transporter activity / transmembrane transporter activityProcessesheme catabolic process / monoatomic ion transport / organic anion transport / transport across blood-brain barrier / xenobiotic metabolic processComponentsapical plasma membrane / basal plasma membrane / basolateral plasma membrane
- General Function
- Mediates the Na(+)-independent transport of steroid sulfate conjugates and other specific organic anions (PubMed:10873595, PubMed:11159893, PubMed:11932330, PubMed:12724351, PubMed:14610227, PubMed:16908597, PubMed:18501590, PubMed:20507927, PubMed:22201122, PubMed:23531488, PubMed:25132355, PubMed:26383540, PubMed:27576593, PubMed:28408210, PubMed:29871943, PubMed:34628357). Responsible for the transport of estrone 3-sulfate (E1S) through the basal membrane of syncytiotrophoblast, highlighting a potential role in the placental absorption of fetal-derived sulfated steroids including the steroid hormone precursor dehydroepiandrosterone sulfate (DHEA-S) (PubMed:11932330, PubMed:12409283). Also facilitates the uptake of sulfated steroids at the basal/sinusoidal membrane of hepatocytes, therefore accounting for the major part of organic anions clearance of liver (PubMed:11159893). Mediates the intestinal uptake of sulfated steroids (PubMed:12724351, PubMed:28408210). Mediates the uptake of the neurosteroids DHEA-S and pregnenolone sulfate (PregS) into the endothelial cells of the blood-brain barrier as the first step to enter the brain (PubMed:16908597, PubMed:25132355). Also plays a role in the reuptake of neuropeptides such as substance P/TAC1 and vasoactive intestinal peptide/VIP released from retinal neurons (PubMed:25132355). May act as a heme transporter that promotes cellular iron availability via heme oxygenase/HMOX2 and independently of TFRC (PubMed:35714613). Also transports heme by-product coproporphyrin III (CPIII), and may be involved in their hepatic disposition (PubMed:26383540). Mediates the uptake of other substrates such as prostaglandins D2 (PGD2), E1 (PGE1) and E2 (PGE2), taurocholate, L-thyroxine, leukotriene C4 and thromboxane B2 (PubMed:10873595, PubMed:14610227, PubMed:19129463, PubMed:29871943, Ref.25). May contribute to regulate the transport of organic compounds in testis across the blood-testis-barrier (Probable). Shows a pH-sensitive substrate specificity which may be ascribed to the protonation state of the binding site and leads to a stimulation of substrate transport in an acidic microenvironment (PubMed:14610227, PubMed:19129463, PubMed:22201122). The exact transport mechanism has not been yet deciphered but most likely involves an anion exchange, coupling the cellular uptake of organic substrate with the efflux of an anionic compound (PubMed:19129463, PubMed:20507927, PubMed:26277985). Hydrogencarbonate/HCO3(-) acts as a probable counteranion that exchanges for organic anions (PubMed:19129463). Cytoplasmic glutamate may also act as counteranion in the placenta (PubMed:26277985). An inwardly directed proton gradient has also been proposed as the driving force of E1S uptake with a (H(+):E1S) stoichiometry of (1:1) (PubMed:20507927)
- Specific Function
- bile acid transmembrane transporter activity
- Pfam Domain Function
- OATP (PF03137)
- Signal Regions
- Not Available
- Transmembrane Regions
- 50-69 89-109 116-140 186-215 235-255 274-298 367-388 409-432 437-460 565-587 597-622 656-673
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0010728|Solute carrier organic anion transporter family member 2B1 (SLCO2B1) ATGGGCACAGAAAACACACCTGGAGGCAAAGCCAGCCCAGACCCTCAGGACGTGCGGCCA AGTGTGTTCCATAACATCAAGCTGTTCGTTCTGTGCCACAGCCTGCTGCAGCTGGCGCAG CTCATGATCTCCGGCTACCTAAAGAGCTCCATCTCCACAGTGGAGAAGCGCTTCGGCCTC TCCAGCCAGACGTCGGGGCTGCTGGCCTCCTTCAACGAGGTGGGGAACACAGCCTTGATT GTGTTTGTGAGCTATTTTGGCAGCCGGGTGCACCGACCCCGAATGATTGGCTATGGGGCT ATCCTTGTGGCCCTGGCGGGCCTGCTCATGACTCTCCCGCACTTCATCTCGGAGCCATAC CGCTACGACAACACCAGCCCTGAGGATATGCCACAGGACTTCAAGGCTTCCCTGTGCCTG CCCACAACCTCGGCCCCAGCCTCGGCCCCCTCCAATGGCAACTGCTCAAGCTACACAGAA ACCCAGCATCTGAGTGTGGTGGGGATCATGTTCGTGGCACAGACCCTGCTGGGCGTGGGC GGGGTGCCCATTCAGCCCTTTGGCATCTCCTACATCGATGACTTTGCCCACAACAGCAAC TCGCCCCTCTACCTCGGGATCCTGTTTGCAGTGACCATGATGGGGCCAGGCCTGGCCTTT GGGCTGGGCAGCCTCATGCTGCGCCTTTATGTGGACATTAACCAGATGCCAGAAGGTGGT ATCAGCCTGACCATAAAGGACCCCCGATGGGTGGGTGCCTGGTGGCTGGGTTTCCTCATC GCTGCCGGTGCAGTGGCCCTGGCTGCCATCCCCTACTTCTTCTTCCCCAAGGAAATGCCC AAGGAAAAACGTGAGCTTCAGTTTCGGCGAAAGGTCTTAGCAGTCACAGACTCACCTGCC AGGAAGGGCAAGGACTCTCCCTCTAAGCAGAGCCCTGGGGAGTCCACGAAGAAGCAGGAT GGCCTAGTCCAGATTGCACCAAACCTGACTGTGATCCAGTTCATTAAAGTCTTCCCCAGG GTGCTGCTGCAGACCCTACGCCACCCCATCTTCCTGCTGGTGGTCCTGTCCCAGGTATGC TTGTCATCCATGGCTGCGGGCATGGCCACCTTCCTGCCCAAGTTCCTGGAGCGCCAGTTT TCCATCACAGCCTCCTACGCCAACCTGCTCATCGGCTGCCTCTCCTTCCCTTCGGTCATC GTGGGCATCGTGGTGGGTGGCGTCCTGGTCAAGCGGCTCCACCTGGGCCCTGTGGGATGC GGTGCCCTTTGCCTGCTGGGGATGCTGCTGTGCCTCTTCTTCAGCCTGCCGCTCTTCTTT ATCGGCTGCTCCAGCCACCAGATTGCGGGCATCACACACCAGACCAGTGCCCACCCTGGG CTGGAGCTGTCTCCAAGCTGCATGGAGGCCTGCTCCTGCCCATTGGACGGCTTTAACCCT GTCTGCGACCCCAGCACTCGTGTGGAATACATCACACCCTGCCACGCAGGCTGCTCAAGC TGGGTGGTCCAGGATGCTCTGGACAACAGCCAGGTTTTCTACACCAACTGCAGCTGCGTG GTGGAGGGCAACCCCGTGCTGGCAGGATCCTGCGACTCAACGTGCAGCCATCTGGTGGTG CCCTTCCTGCTCCTGGTCAGCCTGGGCTCGGCCCTGGCCTGTCTCACCCACACACCCTCC TTCATGCTCATCCTAAGAGGAGTGAAGAAAGAAGACAAGACTTTGGCTGTGGGCATCCAG TTCATGTTCCTGAGGATTTTGGCCTGGATGCCCAGCCCCGTGATCCACGGCAGCGCCATC GACACCACCTGTGTGCACTGGGCCCTGAGCTGTGGGCGTCGAGCTGTCTGTCGCTACTAC AATAATGACCTGCTCCGAAACCGGTTCATCGGCCTCCAGTTCTTCTTCAAAACAGGTTCT GTGATCTGCTTCGCCTTAGTTTTGGCTGTCCTGAGGCAGCAGGACAAAGAGGCAAGGACC AAAGAGAGCAGATCCAGCCCTGCCGTAGAGCAGCAATTGCTAGTGTCGGGGCCAGGGAAG AAGCCAGAGGATTCCCGAGTGTGA
- Chromosome Location
- 11
- Locus
- 11q13.4
- External Identifiers
Resource Link UniProtKB ID O94956 UniProtKB Entry Name SO2B1_HUMAN GenBank Protein ID 5006263 GenBank Gene ID AB026256 GeneCard ID SLCO2B1 GenAtlas ID SLCO2B1 HGNC ID HGNC:10962 KEGG ID hsa:11309 IUPHAR/Guide To Pharmacology ID 1224 NCBI Gene ID 11309 - General References
- Tamai I, Nezu J, Uchino H, Sai Y, Oku A, Shimane M, Tsuji A: Molecular identification and characterization of novel members of the human organic anion transporter (OATP) family. Biochem Biophys Res Commun. 2000 Jun 24;273(1):251-60. [Article]
- Nagase T, Ishikawa K, Suyama M, Kikuno R, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Dec 31;5(6):355-64. [Article]
- Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
- Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [Article]
- Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Hanggi E, Grundschober AF, Leuthold S, Meier PJ, St-Pierre MV: Functional analysis of the extracellular cysteine residues in the human organic anion transporting polypeptide, OATP2B1. Mol Pharmacol. 2006 Sep;70(3):806-17. Epub 2006 Jun 5. [Article]
- Knauer MJ, Girdwood AJ, Kim RB, Tirona RG: Transport function and transcriptional regulation of a liver-enriched human organic anion transporting polypeptide 2B1 transcriptional start site variant. Mol Pharmacol. 2013 Jun;83(6):1218-28. doi: 10.1124/mol.112.083618. Epub 2013 Mar 26. [Article]
- Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]
- Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Estrone approved unknown transporter inhibitor Details Rifampin approved unknown transporter inhibitor Details Phthalic Acid experimental unknown transporter inhibitor Details Oxalic Acid experimental unknown transporter inhibitor Details Niacin approved, investigational, nutraceutical unknown transporter inhibitor Details Lactic acid approved, vet_approved unknown transporter substrateinhibitor Details Citric acid approved, nutraceutical, vet_approved unknown transporter inhibitor Details Benzoic acid approved, investigational unknown transporter inhibitor Details Acetic acid approved unknown transporter substrateinhibitor Details Quercetin experimental, investigational unknown transporter inhibitor Details Naringenin experimental unknown transporter inhibitor Details Alprostadil approved, investigational unknown transporter substrateinhibitor Details Pravastatin approved no transporter substrate Details Dinoprostone approved unknown transporter substrate Details Benzylpenicillin approved, vet_approved unknown transporter substrate Details Conjugated estrogens approved unknown transporter substrate Details Taurocholic acid approved, experimental unknown transporter substrate Details Fexofenadine approved, investigational unknown transporter substrate Details Tolbutamide approved, investigational unknown transporter substrate Details Ibuprofen approved unknown transporter substrate Details Salicylic acid approved, investigational, vet_approved unknown transporter substrate Details Glyburide approved unknown transporter substrate Details Iloprost approved, investigational unknown transporter substrate Details Montelukast approved unknown transporter substrate Details Prasterone sulfate investigational unknown transporter Details Atorvastatin approved no transporter substrate Details Fluvastatin approved unknown transporter Details Rosuvastatin approved unknown transporter Details Pitavastatin approved unknown transporter substrate Details Velpatasvir approved, investigational no transporter inhibitortransporter Details Lifitegrast approved unknown transporter substrate Details Simeprevir approved unknown transporter substrate Details Telaprevir approved, withdrawn unknown target inhibitor Details Bilastine approved, investigational unknown transporter inhibitor Details Estradiol acetate approved, investigational, vet_approved unknown transporter inhibitor Details Estradiol benzoate approved, investigational, vet_approved unknown transporter inhibitor Details Estradiol cypionate approved, investigational, vet_approved unknown transporter inhibitor Details Estradiol dienanthate approved, investigational, vet_approved unknown transporter inhibitor Details Estradiol valerate approved, investigational, vet_approved unknown transporter inhibitor Details Latanoprostene bunod approved, investigational unknown transporter substrate Details Benzbromarone investigational, withdrawn unknown transporter inhibitor Details Cholecystokinin approved, investigational unknown transporter inhibitor Details Diethylstilbestrol approved, investigational, withdrawn unknown transporter substrate Details Dipyridamole approved unknown transporter inhibitor Details Erlotinib approved, investigational unknown transporter inhibitor Details Genistein investigational unknown transporter inhibitor Details Itraconazole approved, investigational unknown transporter inhibitor Details Levothyroxine approved unknown transporter inhibitor Details Nefazodone approved, withdrawn unknown transporter inhibitor Details Nelfinavir approved no transporter inhibitor Details Novobiocin approved, investigational, vet_approved, withdrawn unknown transporter inhibitor Details Piroxicam approved, investigational unknown transporter inhibitor Details Reserpine approved, investigational, withdrawn unknown transporter inhibitor Details Silibinin experimental, investigational unknown transporter inhibitor Details Sulfasalazine approved no transporter inhibitor Details Tetracycline approved, vet_approved, withdrawn unknown transporter inhibitor Details Tipranavir approved, investigational unknown transporter inhibitor Details Valproic acid approved, investigational unknown transporter inhibitor Details Indinavir approved unknown transporter inhibitor Details Saquinavir approved, investigational unknown transporter inhibitor Details Ritonavir approved, investigational unknown transporter inhibitor Details Asunaprevir approved, investigational, withdrawn unknown transporter substrateinhibitor Details Dovitinib investigational unknown transporter inhibitor Details Dexibuprofen approved, investigational unknown transporter Details Rifamycin approved, investigational no transporter inhibitor Details Simvastatin approved unknown transporter Details Lovastatin approved, investigational unknown transporter Details Pexidartinib approved, investigational unknown transporter inhibitor Details Gemfibrozil approved unknown target inhibitor Details Atazanavir approved, investigational no transporter inhibitor Details Prasterone approved, investigational, nutraceutical unknown transporter substrate Details Opicapone approved, investigational no transporter substrate Details Diosmin approved, investigational unknown transporter Details Maralixibat approved, investigational unknown transporter inhibitor Details Tenapanor approved, investigational unknown transporter inhibitor Details Mesalazine approved unknown transporter substrate Details Elacestrant approved, investigational unknown transporter substrate Details