Identification

Summary

Papain is a proteolytic enzyme derived from papaya used for its anti-inflammatory properties.

Generic Name
Papain
DrugBank Accession Number
DB11193
Background

Papain, also known as papaya proteinase I, is a cysteine protease (EC 3.4.22.2) enzyme that is found in species of papaya, Carica papaya and Vasconcellea cundinamarcensis. The enzyme is found to be localized in the skin of papaya, and is collected from slashed unripe papayas as a crude latex. Papain is used in food, pharmaceutical, textile, and cosmetic industries. While it has been used for the treatment of inflammation and pain via topical administration, papain has also shown to have anthelmintic and tooth-whitening properties. Present in over-the-counter mixture products consisting of different digestive enzymes, its active site contains a catalytic diad that plays a role in breaking peptide bonds. Papain is also used as an ingredient in various enzymatic debriding preparations.

Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Peptides
Protein Chemical Formula
Not Available
Protein Average Weight
Not Available
Sequences
>PAPA1_CARPA, Papain, Carica papaya
MAMIPSISKLLFVAICLFVYMGLSFGDFSIVGYSQNDLTSTERLIQLFESWMLKHNKIYK
NIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEFKEKYTGSIAGNYTTTE
LSYEEVLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNE
YSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKT
DGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYG
PNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
References:
  1. UniProt: P00784, PAPA1_CARPA [Link]
Download FASTA Format
Synonyms
  • Papain
  • Papaína

Pharmacology

Indication

No FDA-approved therapeutic indications.

Reduce drug development failure rates
Build, train, & validate machine-learning models
with evidence-based and structured datasets.
See how
Build, train, & validate predictive machine-learning models with structured datasets.
See how
Associated Conditions
Contraindications & Blackbox Warnings
Avoid life-threatening adverse drug events
Improve clinical decision support with information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.
Learn more
Avoid life-threatening adverse drug events & improve clinical decision support.
Learn more
Pharmacodynamics

Papain is a digestive enzyme and often acts as a skin allergen.

Mechanism of action

When topically applied, papain induces an allergen-like inflammatory response via recruiting neutrophils, mast cells, and CD3-positive cells and by induction of a TH2-biased antibody response 1. In vitro, treatment of papain resulted in the breakdown of tight junctions of primary human keratinocytes that maintain the epithelial barrier integrity. These tight junction proteins include zonula occludens-1, claudin-4, and occludin 1. It is proposed that papain induces allergic responses via activation of TLR4, leading to an increase in neutrophils, CD3+ cells, mast cells, and CCL8-positive cells 1.

TargetActionsOrganism
UToll-like receptor 4
activator
Humans
Absorption

No pharmacokinetic data available.

Volume of distribution

No pharmacokinetic data available.

Protein binding

No pharmacokinetic data available.

Metabolism

No pharmacokinetic data available.

Route of elimination

No pharmacokinetic data available.

Half-life

No pharmacokinetic data available.

Clearance

No pharmacokinetic data available.

Adverse Effects
Improve decision support & research outcomes
With structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates.
Learn more
Improve decision support & research outcomes with our structured adverse effects data.
Learn more
Toxicity

Acute oral LD50 of 200 mcu papain is 4000 mg/kg in rat and 12500 mg/kg in mouse MSDS. It acts as an irritant in case of inhalation or contact with eyes.

Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
Not Available
Food Interactions
No interactions found.

Products

Drug product information from 10+ global regions
Our datasets provide approved product information including:
dosage, form, labeller, route of administration, and marketing period.
Access now
Access drug product information from over 10 global regions.
Access now
Over the Counter Products
NameDosageStrengthRouteLabellerMarketing StartMarketing EndRegionImage
AXCEL PAPAIN TABLETTablet10000 UOralKOTRA PHARMA (M) SDN. BHD.2017-10-062019-05-09Malaysia flag
Axcel Papain Tablet 10,000 USP UnitsTabletOralKOTRA PHARMA (M) SDN. BHD.2020-09-08Not applicableMalaysia flag
AXCEL PAPAIN TABLETS 10,000 unitsTablet10000 unitsOralKOTRA PHARMA MARKETING1999-12-03Not applicable
BEAUTIFUL CONTRACT - Deep V Breast contract -Hui Ju Sheng Enterprise Corporation Ltd.Capsule, gelatin coated35 mg/500mgOralPhytopia Co., Ltd.2016-04-012017-02-01US flag
BEAZYME TABLETTabletOralDUOPHARMA MANUFACTURING (BANGI) SDN BHD2020-09-08Not applicableMalaysia flag
CAMPAIN TABLETTablet10000 UOralCHULIA PHARMA SDN BHD2017-10-032019-09-11Malaysia flag
NORIPAPAIN 10 000 USP UNITS TABLETTabletOralNoripharma Sdn. Bhd.2020-09-08Not applicableMalaysia flag
NORIPAPAIN 150 000 USP UNITS TABLETTabletOralNoripharma Sdn. Bhd.2020-09-08Not applicableMalaysia flag
Papaya Enzyme - Tablet 30 mgTablet30 mgOralHealth Wise Nutrition Inc.1997-08-152000-07-29Canada flag
Papaya Enzyme TabTablet29.5 mgOralCarmaran LtÉe1979-12-311996-09-09Canada flag
Mixture Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing EndRegionImage
Bromelain and Papain TabPapain (35 mg) + Bromelains (75 mg)TabletOralVita Health Products Inc1978-12-312002-07-31Canada flag
Chewable Enzymes TabletsPapain (100 mg) + Bromelains (15 mg) + Pancrelipase amylase (5 mg)TabletOralGahler Enterprises Ltd.1988-12-312002-07-17Canada flag
DygestPapain (100 mg) + Betaine hydrochloride (90 mg) + Ox bile extract (75 mg) + Pancrelipase (200 mg) + Peppermint (50 mg) + Pepsin (125 mg)TabletOralCreative Nutrition Canada Corp.1987-12-312007-07-11Canada flag
Enzyme TabletsPapain (65 mg) + Betaine hydrochloride (65 mg) + Ox bile extract (8.125 mg) + Pancrelipase (100 mg) + Pancrelipase amylase (130 mg) + Pepsin (65 mg)TabletOralGeneral Nutrition Canada Inc.2001-10-202007-08-01Canada flag
Herbalax Forte No 70 TabPapain (129.6 mg) + Capsicum oleoresin (1.62 mg) + Frangula purshiana bark (97.2 mg) + Phenolphthalein (97.2 mg) + Sodium taurocholate (64.8 mg)TabletOralSantÉ Naturelle (Ag) LtÉe1981-12-311997-09-09Canada flag
Master Key Formula 3 TabPapain (50 mg) + Niacin (11.5 mg) + Silicon dioxide (50 mcg)TabletOralNutrition For Life International1997-01-272000-08-11Canada flag
NATURE'S BOUNTY NATUREL B-COMPLEX AND B-12 TABLET, 90 ADETPapain (10 mg) + Cyanocobalamin (100 μg) + Niacin (5 mg) + Riboflavin (2.5 mg) + Thiamine (2.5 mg)TabletOralNAVITA ILAC VE SAGLIK URUNLERI SAN TIC LTD STI2020-08-142018-09-27Turkey flag
Neo Life Beta Gest TabPapain (10 mg) + Betaine hydrochloride (275 mg) + Pepsin (130 mg)TabletOralGolden Neo Life International Ltd.1979-12-311997-08-01Canada flag
Neo Life Enzyme TabPapain (50 mg) + Pancrelipase (200 mg) + Pepsin (125 mg)TabletOralGolden Neo Life International Ltd.1979-12-311997-08-01Canada flag
Papaya Bromelain MycozymePapain (30 mg) + Bromelains (45 mg) + Pancrelipase amylase (30 mg)TabletOralAlive Vitamins1985-12-312002-07-12Canada flag
Unapproved/Other Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing EndRegionImage
BEAUTIFUL CONTRACT - Deep V Breast contract -Hui Ju Sheng Enterprise Corporation Ltd.Papain (35 mg/500mg)Capsule, gelatin coatedOralPhytopia Co., Ltd.2016-04-012017-02-01US flag
PuralorPapain (20 mg/1) + 1-(c14-c18 esteroyl)-2-docosahexanoyl-sn-glycero-3-phosphocholine (5 mg/1) + 1-(c14-c18 esteroyl)-2-docosahexanoyl-sn-glycero-3-phosphoethanolamine (2.5 mg/1) + Acetylcysteine amide (5 mg/1) + Ascorbic acid (25 mg/1) + Cholecalciferol (100 [iU]/1) + Citric acid (1.6 mg/1) + Cobamamide (2 mg/1) + Egg phospholipids (42.5 mg/1) + Folic acid (42.5 mg/1) + Gastric intrinsic factor (2.5 mg/1) + Magnesium L-threonate (2.5 mg/1) + Leucovorin (3 mg/1) + Levomefolic acid (0.4 mg/1) + Magnesium glycinate (1 mg/1) + Niacin (0.5 mg/1) + Pantethine (2.5 mg/1) + Riboflavin (0.5 mg/1) + Sodium citrate (0.8 mg/1) + Thiamine chloride (0.5 mg/1)Tablet, chewableOralCenturion Labs2014-01-012017-09-20US flag

Categories

Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available
Affected organisms
Not Available

Chemical Identifiers

UNII
A236A06Y32
CAS number
9001-73-4

References

General References
  1. Stremnitzer C, Manzano-Szalai K, Willensdorfer A, Starkl P, Pieper M, Konig P, Mildner M, Tschachler E, Reichart U, Jensen-Jarolim E: Papain Degrades Tight Junction Proteins of Human Keratinocytes In Vitro and Sensitizes C57BL/6 Mice via the Skin Independent of its Enzymatic Activity or TLR4 Activation. J Invest Dermatol. 2015 Jul;135(7):1790-1800. doi: 10.1038/jid.2015.58. Epub 2015 Feb 23. [Article]
PubChem Substance
347911149
RxNav
7892
Wikipedia
Papain
MSDS
Download (47.7 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
Not AvailableCompletedBasic SciencePapain / Pruritus / Skin Prick Test (SPT)1
Not AvailableCompletedBasic SciencePruritus1
Not AvailableUnknown StatusTreatmentMicrobial Colonization1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage Forms
FormRouteStrength
TabletOral10000 U
TabletOral10000 units
Capsule, gelatin coatedOral35 mg/500mg
TabletOral
TabletOral29.5 mg
TabletOral200 mg
TabletOral30 mg
CapsuleOral
GelTopical0.5 g
CreamTopical0.5 g
TabletOral
Tablet, chewableOral
Tablet, delayed releaseOral
Prices
Not Available
Patents
Not Available

Properties

State
Solid
Experimental Properties
PropertyValueSource
water solubilitySoluble in cold waterMSDS

Targets

Build, predict & validate machine-learning models
Use our structured and evidence-based datasets to unlock new
insights and accelerate drug research.
Learn more
Use our structured and evidence-based datasets to unlock new insights and accelerate drug research.
Learn more
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
Actions
Activator
Curator comments
Activation is indicated in vitro.
General Function
Transmembrane signaling receptor activity
Specific Function
Cooperates with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MYD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and ...
Gene Name
TLR4
Uniprot ID
O00206
Uniprot Name
Toll-like receptor 4
Molecular Weight
95679.19 Da
References
  1. Stremnitzer C, Manzano-Szalai K, Willensdorfer A, Starkl P, Pieper M, Konig P, Mildner M, Tschachler E, Reichart U, Jensen-Jarolim E: Papain Degrades Tight Junction Proteins of Human Keratinocytes In Vitro and Sensitizes C57BL/6 Mice via the Skin Independent of its Enzymatic Activity or TLR4 Activation. J Invest Dermatol. 2015 Jul;135(7):1790-1800. doi: 10.1038/jid.2015.58. Epub 2015 Feb 23. [Article]

Drug created at December 03, 2015 16:51 / Updated at December 08, 2022 17:54