Muscarinic acetylcholine receptor M3
Details
- Name
- Muscarinic acetylcholine receptor M3
- Synonyms
- Not Available
- Gene Name
- CHRM3
- UniProtKB Entry
- P20309Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0009898|Muscarinic acetylcholine receptor M3 MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPL GGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVI SMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR TTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSF PKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKR MSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVN PVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL
- Number of residues
- 590
- Molecular Weight
- 66127.445
- Theoretical pI
- 9.62
- GO Classification
- FunctionsG protein-coupled acetylcholine receptor activity / G protein-coupled serotonin receptor activity / signaling receptor activityProcessesacetylcholine receptor signaling pathway / adenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway / calcium-mediated signaling / chemical synaptic transmission / G protein-coupled acetylcholine receptor signaling pathway / G protein-coupled receptor signaling pathway / G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger / ion channel modulating, G protein-coupled receptor signaling pathway / ligand-gated ion channel signaling pathway / phospholipase C-activating G protein-coupled acetylcholine receptor signaling pathway / positive regulation of insulin secretion / protein modification process / regulation of monoatomic ion transmembrane transporter activity / regulation of smooth muscle contractionComponentsbasal plasma membrane / endoplasmic reticulum membrane
- General Function
- The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover
- Specific Function
- Acetylcholine binding
- Pfam Domain Function
- 7tm_1 (PF00001)
- Signal Regions
- Not Available
- Transmembrane Regions
- 68-91 105-130 143-164 185-206 230-252 492-514 527-546
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0009899|Muscarinic acetylcholine receptor M3 (CHRM3) ATGACCTTGCACAATAACAGTACAACCTCGCCTTTGTTTCCAAACATCAGCTCCTCCTGG ATACACAGCCCCTCCGATGCAGGGCTGCCCCCGGGAACCGTCACTCATTTCGGCAGCTAC AATGTTTCTCGAGCAGCTGGCAATTTCTCCTCTCCAGACGGTACCACCGATGACCCTCTG GGAGGTCATACCGTCTGGCAAGTGGTCTTCATCGCTTTCTTAACGGGCATCCTGGCCTTG GTGACCATCATCGGCAACATCCTGGTAATTGTGTCATTTAAGGTCAACAAGCAGCTGAAG ACGGTCAACAACTACTTCCTCTTAAGCCTGGCCTGTGCCGATCTGATTATCGGGGTCATT TCAATGAATCTGTTTACGACCTACATCATCATGAATCGATGGGCCTTAGGGAACTTGGCC TGTGACCTCTGGCTTGCCATTGACTACGTAGCCAGCAATGCCTCTGTTATGAATCTTCTG GTCATCAGCTTTGACAGATACTTTTCCATCACGAGGCCGCTCACGTACCGAGCCAAACGA ACAACAAAGAGAGCCGGTGTGATGATCGGTCTGGCTTGGGTCATCTCCTTTGTCCTTTGG GCTCCTGCCATCTTGTTCTGGCAATACTTTGTTGGAAAGAGAACTGTGCCTCCGGGAGAG TGCTTCATTCAGTTCCTCAGTGAGCCCACCATTACTTTTGGCACAGCCATCGCTGCTTTT TATATGCCTGTCACCATTATGACTATTTTATACTGGAGGATCTATAAGGAAACTGAAAAG CGTACCAAAGAGCTTGCTGGCCTGCAAGCCTCTGGGACAGAGGCAGAGACAGAAAACTTT GTCCACCCCACGGGCAGTTCTCGAAGCTGCAGCAGTTACGAACTTCAACAGCAAAGCATG AAACGCTCCAACAGGAGGAAGTATGGCCGCTGCCACTTCTGGTTCACAACCAAGAGCTGG AAACCCAGCTCCGAGCAGATGGACCAAGACCACAGCAGCAGTGACAGTTGGAACAACAAT GATGCTGCTGCCTCCCTGGAGAACTCCGCCTCCTCCGACGAGGAGGACATTGGCTCCGAG ACGAGAGCCATCTACTCCATCGTGCTCAAGCTTCCGGGTCACAGCACCATCCTCAACTCC ACCAAGTTACCCTCATCGGACAACCTGCAGGTGCCTGAGGAGGAGCTGGGGATGGTGGAC TTGGAGAGGAAAGCCGACAAGCTGCAGGCCCAGAAGAGCGTGGACGATGGAGGCAGTTTT CCAAAAAGCTTCTCCAAGCTTCCCATCCAGCTAGAGTCAGCCGTGGACACAGCTAAGACT TCTGACGTCAACTCCTCAGTGGGTAAGAGCACGGCCACTCTACCTCTGTCCTTCAAGGAA GCCACTCTGGCCAAGAGGTTTGCTCTGAAGACCAGAAGTCAGATCACTAAGCGGAAAAGG ATGTCCCTGGTCAAGGAGAAGAAAGCGGCCCAGACCCTCAGTGCGATCTTGCTTGCCTTC ATCATCACTTGGACCCCATACAACATCATGGTTCTGGTGAACACCTTTTGTGACAGCTGC ATACCCAAAACCTTTTGGAATCTGGGCTACTGGCTGTGCTACATCAACAGCACCGTGAAC CCCGTGTGCTATGCTCTGTGCAACAAAACATTCAGAACCACTTTCAAGATGCTGCTGCTG TGCCAGTGTGACAAAAAAAAGAGGCGCAAGCAGCAGTACCAGCAGAGACAGTCGGTCATT TTTCACAAGCGCGCACCCGAGCAGGCCTTGTAG
- Chromosome Location
- 1
- Locus
- 1q43
- External Identifiers
Resource Link UniProtKB ID P20309 UniProtKB Entry Name ACM3_HUMAN GenBank Protein ID 32324 GenBank Gene ID X15266 GeneCard ID CHRM3 GenAtlas ID CHRM3 HGNC ID HGNC:1952 PDB ID(s) 2CSA, 8E9W, 8E9Y, 8E9Z, 8EA0 KEGG ID hsa:1131 IUPHAR/Guide To Pharmacology ID 15 NCBI Gene ID 1131 - General References
- Peralta EG, Ashkenazi A, Winslow JW, Smith DH, Ramachandran J, Capon DJ: Distinct primary structures, ligand-binding properties and tissue-specific expression of four human muscarinic acetylcholine receptors. EMBO J. 1987 Dec 20;6(13):3923-9. [Article]
- Bonner TI, Young AC, Brann MR, Buckley NJ: Cloning and expression of the human and rat m5 muscarinic acetylcholine receptor genes. Neuron. 1988 Jul;1(5):403-10. [Article]
- Kitano T, Liu YH, Ueda S, Saitou N: Human-specific amino acid changes found in 103 protein-coding genes. Mol Biol Evol. 2004 May;21(5):936-44. Epub 2004 Mar 10. [Article]
- Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Speek M: Antisense promoter of human L1 retrotransposon drives transcription of adjacent cellular genes. Mol Cell Biol. 2001 Mar;21(6):1973-85. [Article]
- Yang J, Williams JA, Yule DI, Logsdon CD: Mutation of carboxyl-terminal threonine residues in human m3 muscarinic acetylcholine receptor modulates the extent of sequestration and desensitization. Mol Pharmacol. 1995 Sep;48(3):477-85. [Article]
- Weber S, Thiele H, Mir S, Toliat MR, Sozeri B, Reutter H, Draaken M, Ludwig M, Altmuller J, Frommolt P, Stuart HM, Ranjzad P, Hanley NA, Jennings R, Newman WG, Wilcox DT, Thiel U, Schlingmann KP, Beetz R, Hoyer PF, Konrad M, Schaefer F, Nurnberg P, Woolf AS: Muscarinic Acetylcholine Receptor M3 Mutation Causes Urinary Bladder Disease and a Prune-Belly-like Syndrome. Am J Hum Genet. 2011 Nov 11;89(5):668-74. doi: 10.1016/j.ajhg.2011.10.007. [Article]
- Patowary S, Alvarez-Curto E, Xu TR, Holz JD, Oliver JA, Milligan G, Raicu V: The muscarinic M3 acetylcholine receptor exists as two differently sized complexes at the plasma membrane. Biochem J. 2013 Jun 1;452(2):303-12. doi: 10.1042/BJ20121902. [Article]
- Iverson HA, Fox D 3rd, Nadler LS, Klevit RE, Nathanson NM: Identification and structural determination of the M(3) muscarinic acetylcholine receptor basolateral sorting signal. J Biol Chem. 2005 Jul 1;280(26):24568-75. Epub 2005 May 2. [Article]
Associated Data
- Bio-Entities
Bio-Entity Type Muscarinic acetylcholine receptor M3 (Humans) protein primaryMuscarinic acetylcholine receptor (Humans) protein - Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Darifenacin approved, investigational yes target antagonist Details Diphemanil approved, vet_approved, withdrawn yes target antagonist Details Cevimeline approved yes target agonist Details Olanzapine approved, investigational unknown target antagonist Details Oxyphencyclimine approved yes target antagonist Details Tridihexethyl withdrawn yes target antagonist Details Anisotropine methylbromide approved yes target antagonist Details Atropine approved, vet_approved yes target antagonist Details Homatropine methylbromide approved yes target antagonist Details Benzquinamide withdrawn yes target antagonist Details Promethazine approved, investigational unknown target antagonist Details Diphenidol approved, investigational, withdrawn yes target antagonist Details Methotrimeprazine approved, investigational unknown target antagonist Details Tiotropium approved yes target antagonist Details Solifenacin approved yes target antagonist Details Oxybutynin approved, investigational yes target antagonist Details Tolterodine approved, investigational yes target antagonist Details ALKS 27 investigational unknown target Details Ipratropium approved, experimental yes target antagonist Details Nicardipine approved, investigational unknown target antagonist Details Fesoterodine approved yes target antagonist Details Quetiapine approved unknown target antagonist Details Ziprasidone approved unknown target antagonist Details Clozapine approved unknown target antagonist Details Pipecuronium approved unknown target antagonist Details Pancuronium approved unknown target antagonist Details Disopyramide approved unknown target antagonist Details Terfenadine approved, withdrawn unknown target antagonist Details Hyoscyamine approved unknown target antagonist Details Chlorprothixene approved, experimental, investigational, withdrawn no target antagonist Details Doxepin approved, investigational unknown target antagonist Details Desipramine approved, investigational no target antagonist Details Imipramine approved no target antagonist Details Cyproheptadine approved unknown target antagonist Details Brompheniramine approved unknown target antagonist Details Tropicamide approved, investigational unknown target antagonist Details Scopolamine approved, investigational yes target antagonist Details Procyclidine approved yes target antagonist Details Trihexyphenidyl approved unknown target antagonist Details Mivacurium approved no target antagonist Details Pilocarpine approved, investigational yes target agonist Details Succinylcholine approved unknown target agonist Details Maprotiline approved, investigational no target antagonist Details Mepenzolate approved yes target antagonist Details Isopropamide approved, vet_approved yes target antagonist Details Methacholine approved, investigational yes target agonist Details Tramadol approved, investigational unknown target antagonist Details Methscopolamine bromide approved unknown target antagonist Details Aclidinium approved yes target antagonist Details Chlorpromazine approved, investigational, vet_approved unknown target antagonist Details Loxapine approved unknown target binder Details Glycopyrronium approved, investigational, vet_approved yes target antagonist Details Umeclidinium approved yes target antagonist Details Hexocyclium approved yes target antagonist Details Butylscopolamine approved, investigational, vet_approved yes target antagonist Details Dosulepin approved yes target antagonist Details Imidafenacin investigational yes target antagonist Details Acetylcholine approved, investigational unknown target Details Thiopental approved, vet_approved unknown target Details Carbamoylcholine approved unknown target agonist Details Arecoline experimental unknown target Details Bethanechol approved yes target agonist Details Homatropine approved yes target antagonist Details Pizotifen approved unknown target antagonist Details Propiverine approved, investigational yes target antagonist Details Thonzylamine approved unknown target antagonist Details Rociverine experimental yes target antagonist Details Trimebutine approved yes target antagonist Details Aripiprazole lauroxil approved, investigational no target Details Haloperidol approved unknown target Details Aripiprazole approved, investigational unknown target ligand Details Trospium approved unknown target Details Methantheline approved, investigational unknown target Details Dicyclomine approved unknown target antagonist Details Viloxazine approved, investigational, withdrawn unknown target antagonist Details Sofpironium approved, investigational yes target inhibitor Details Vinburnine experimental yes target allosteric modulator Details Tarafenacin investigational yes target antagonist Details Methscopolamine approved yes target antagonist Details Aceclidine approved yes target inhibitor Details Metixene approved yes target antagonist Details Doxylamine approved, vet_approved unknown target antagonist Details Propiomazine approved unknown target antagonist Details Amoxapine approved unknown target antagonist Details Trimipramine approved unknown target binder Details Meperidine approved unknown target binder Details Cinnarizine approved, investigational unknown target binder Details Ketamine approved, vet_approved unknown target binder Details Etoperidone withdrawn unknown target antagonist Details Revefenacin approved, investigational yes target antagonist Details Amitriptyline approved unknown target ligand Details Paroxetine approved, investigational unknown target inhibitor Details Nortriptyline approved unknown target antagonist Details Sofpironium approved, investigational yes target inhibitor Details