5-hydroxytryptamine receptor 2C

Details

Name
5-hydroxytryptamine receptor 2C
Synonyms
  • 5-HT-1C
  • 5-HT-2C
  • 5-HT1C
  • 5-HT2C
  • 5-HTR2C
  • 5-hydroxytryptamine receptor 1C
  • HTR1C
  • Serotonin receptor 2C
Gene Name
HTR2C
UniProtKB Entry
P28335Swiss-Prot
Organism
Humans
NCBI Taxonomy ID
9606
Amino acid sequence
>lcl|BSEQ0056276|5-hydroxytryptamine receptor 2C
MVNLRNAVHSFLVHLIGLLVWQSDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
ISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV
LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM
QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC
SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN
EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
Number of residues
458
Molecular Weight
51804.645
Theoretical pI
9.11
GO Classification
Functions
G protein-coupled serotonin receptor activity / identical protein binding / neurotransmitter receptor activity
Processes
cGMP-mediated signaling / chemical synaptic transmission / G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger / G protein-coupled serotonin receptor signaling pathway / intracellular calcium ion homeostasis / phospholipase C-activating G protein-coupled receptor signaling pathway / positive regulation of calcium-mediated signaling / regulation of nervous system process
Components
dendrite / G protein-coupled serotonin receptor complex / synapse
General Function
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various drugs and psychoactive substances, including ergot alkaloid derivatives, 1-2,5,-dimethoxy-4-iodophenyl-2-aminopropane (DOI) and lysergic acid diethylamide (LSD). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling activates a phosphatidylinositol-calcium second messenger system that modulates the activity of phosphatidylinositol 3-kinase and down-stream signaling cascades and promotes the release of Ca(2+) ions from intracellular stores. Regulates neuronal activity via the activation of short transient receptor potential calcium channels in the brain, and thereby modulates the activation of pro-opiomelacortin neurons and the release of CRH that then regulates the release of corticosterone. Plays a role in the regulation of appetite and eating behavior, responses to anxiogenic stimuli and stress. Plays a role in insulin sensitivity and glucose homeostasis
Specific Function
1-(4-iodo-2,5-dimethoxyphenyl)propan-2-amine binding
Pfam Domain Function
Signal Regions
1-32
Transmembrane Regions
53-78 90-110 128-150 171-193 214-235 312-333 349-371
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010373|5-hydroxytryptamine receptor 2C (HTR2C)
ATGGTGAACCTGAGGAATGCGGTGCATTCATTCCTTGTGCACCTAATTGGCCTATTGGTT
TGGCAATGTGATATTTCTGTGAGCCCAGTAGCAGCTATAGTAACTGACATTTTCAATACC
TCCGATGGTGGACGCTTCAAATTCCCAGACGGGGTACAAAACTGGCCAGCACTTTCAATC
GTCATCATAATAATCATGACAATAGGTGGCAACATCCTTGTGATCATGGCAGTAAGCATG
GAAAAGAAACTGCACAATGCCACCAATTACTTCTTAATGTCCCTAGCCATTGCTGATATG
CTAGTGGGACTACTTGTCATGCCCCTGTCTCTCCTGGCAATCCTTTATGATTATGTCTGG
CCACTACCTAGATATTTGTGCCCCGTCTGGATTTCTTTAGATGTTTTATTTTCAACAGCG
TCCATCATGCACCTCTGCGCTATATCGCTGGATCGGTATGTAGCAATACGTAATCCTATT
GAGCATAGCCGTTTCAATTCGCGGACTAAGGCCATCATGAAGATTGCTATTGTTTGGGCA
ATTTCTATAGGTGTATCAGTTCCTATCCCTGTGATTGGACTGAGGGACGAAGAAAAGGTG
TTCGTGAACAACACGACGTGCGTGCTCAACGACCCAAATTTCGTTCTTATTGGGTCCTTC
GTAGCTTTCTTCATACCGCTGACGATTATGGTGATTACGTATTGCCTGACCATCTACGTT
CTGCGCCGACAAGCTTTGATGTTACTGCACGGCCACACCGAGGAACCGCCTGGACTAAGT
CTGGATTTCCTGAAGTGCTGCAAGAGGAATACGGCCGAGGAAGAGAACTCTGCAAACCCT
AACCAAGACCAGAACGCACGCCGAAGAAAGAAGAAGGAGAGACGTCCTAGGGGCACCATG
CAGGCTATCAACAATGAAAGAAAAGCTTCGAAAGTCCTTGGGATTGTTTTCTTTGTGTTT
CTGATCATGTGGTGCCCATTTTTCATTACCAATATTCTGTCTGTTCTTTGTGAGAAGTCC
TGTAACCAAAAGCTCATGGAAAAGCTTCTGAATGTGTTTGTTTGGATTGGCTATGTTTGT
TCAGGAATCAATCCTCTGGTGTATACTCTGTTCAACAAAATTTACCGAAGGGCATTCTCC
AACTATTTGCGTTGCAATTATAAGGTAGAGAAAAAGCCTCCTGTCAGGCAGATTCCAAGA
GTTGCCGCCACTGCTTTGTCTGGGAGGGAGCTTAATGTTAACATTTATCGGCATACCAAT
GAACCGGTGATCGAGAAAGCCAGTGACAATGAGCCCGGTATAGAGATGCAAGTTGAGAAT
TTAGAGTTACCAGTAAATCCCTCCAGTGTGGTTAGCGAAAGGATTAGCAGTGTGTGA
Chromosome Location
X
Locus
Xq23
External Identifiers
ResourceLink
UniProtKB IDP28335
UniProtKB Entry Name5HT2C_HUMAN
GenBank Protein ID338028
GenBank Gene IDM81778
GeneCard IDHTR2C
GenAtlas IDHTR2C
HGNC IDHGNC:5295
PDB ID(s)6BQG, 6BQH, 8DPF, 8DPG, 8DPH, 8DPI
KEGG IDhsa:3358
IUPHAR/Guide To Pharmacology ID8
NCBI Gene ID3358
General References
  1. Saltzman AG, Morse B, Whitman MM, Ivanshchenko Y, Jaye M, Felder S: Cloning of the human serotonin 5-HT2 and 5-HT1C receptor subtypes. Biochem Biophys Res Commun. 1991 Dec 31;181(3):1469-78. [Article]
  2. Stam NJ, Vanderheyden P, van Alebeek C, Klomp J, de Boer T, van Delft AM, Olijve W: Genomic organisation and functional expression of the gene encoding the human serotonin 5-HT2C receptor. Eur J Pharmacol. 1994 Nov 15;269(3):339-48. [Article]
  3. Xie E, Zhu L, Zhao L, Chang LS: The human serotonin 5-HT2C receptor: complete cDNA, genomic structure, and alternatively spliced variant. Genomics. 1996 Aug 1;35(3):551-61. [Article]
  4. Niswender CM, Sanders-Bush E, Emeson RB: Identification and characterization of RNA editing events within the 5-HT2C receptor. Ann N Y Acad Sci. 1998 Dec 15;861:38-48. [Article]
  5. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
  6. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [Article]
  7. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  8. Becamel C, Figge A, Poliak S, Dumuis A, Peles E, Bockaert J, Lubbert H, Ullmer C: Interaction of serotonin 5-hydroxytryptamine type 2C receptors with PDZ10 of the multi-PDZ domain protein MUPP1. J Biol Chem. 2001 Apr 20;276(16):12974-82. Epub 2001 Jan 9. [Article]
  9. Schaerlinger B, Hickel P, Etienne N, Guesnier L, Maroteaux L: Agonist actions of dihydroergotamine at 5-HT2B and 5-HT2C receptors and their possible relevance to antimigraine efficacy. Br J Pharmacol. 2003 Sep;140(2):277-84. Epub 2003 Aug 11. [Article]
  10. Marion S, Oakley RH, Kim KM, Caron MG, Barak LS: A beta-arrestin binding determinant common to the second intracellular loops of rhodopsin family G protein-coupled receptors. J Biol Chem. 2006 Feb 3;281(5):2932-8. Epub 2005 Nov 30. [Article]
  11. Nichols DE, Nichols CD: Serotonin receptors. Chem Rev. 2008 May;108(5):1614-41. doi: 10.1021/cr078224o. Epub 2008 May 14. [Article]
  12. Cussac D, Boutet-Robinet E, Ailhaud MC, Newman-Tancredi A, Martel JC, Danty N, Rauly-Lestienne I: Agonist-directed trafficking of signalling at serotonin 5-HT2A, 5-HT2B and 5-HT2C-VSV receptors mediated Gq/11 activation and calcium mobilisation in CHO cells. Eur J Pharmacol. 2008 Oct 10;594(1-3):32-8. doi: 10.1016/j.ejphar.2008.07.040. Epub 2008 Jul 30. [Article]
  13. Knauer CS, Campbell JE, Chio CL, Fitzgerald LW: Pharmacological characterization of mitogen-activated protein kinase activation by recombinant human 5-HT2C, 5-HT2A, and 5-HT2B receptors. Naunyn Schmiedebergs Arch Pharmacol. 2009 May;379(5):461-71. doi: 10.1007/s00210-008-0378-4. Epub 2008 Dec 5. [Article]
  14. Pytliak M, Vargova V, Mechirova V, Felsoci M: Serotonin receptors - from molecular biology to clinical applications. Physiol Res. 2011;60(1):15-25. Epub 2010 Oct 15. [Article]
  15. Jahnsen JA, Uhlen S: The N-terminal region of the human 5-HT(2)C receptor has as a cleavable signal peptide. Eur J Pharmacol. 2012 Jun 5;684(1-3):44-50. doi: 10.1016/j.ejphar.2012.03.043. Epub 2012 Apr 3. [Article]
  16. Lappalainen J, Zhang L, Dean M, Oz M, Ozaki N, Yu DH, Virkkunen M, Weight F, Linnoila M, Goldman D: Identification, expression, and pharmacology of a Cys23-Ser23 substitution in the human 5-HT2c receptor gene (HTR2C). Genomics. 1995 May 20;27(2):274-9. [Article]
  17. Samochowiec J, Smolka M, Winterer G, Rommelspacher H, Schmidt LG, Sander T: Association analysis between a Cys23Ser substitution polymorphism of the human 5-HT2c receptor gene and neuronal hyperexcitability. Am J Med Genet. 1999 Apr 16;88(2):126-30. [Article]
  18. Marshall SE, Bird TG, Hart K, Welsh KI: Unified approach to the analysis of genetic variation in serotonergic pathways. Am J Med Genet. 1999 Dec 15;88(6):621-7. [Article]
  19. Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES: Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. 1999 Jul;22(3):231-8. [Article]

Associated Data

Bio-Entities
Bio-EntityType
5-hydroxytryptamine receptor 2C (Humans)protein
primary
Serotonin Receptors (Humans)protein
5-hydroxytryptamine 2 receptor (Humans)protein
5-hydroxytryptamine receptor 2 (Humans)protein
Drug Relations
DrugDrug groupPharmacological action?TypeActionsDetails
Fenfluramineapproved, illicit, investigational, withdrawnyestargetagonistDetails
ZiprasidoneapprovedyestargetantagonistDetails
Olanzapineapproved, investigationalunknowntargetantagonistDetails
MirtazapineapprovedyestargetantagonistDetails
Promazineapproved, vet_approvedunknowntargetantagonistDetails
PropiomazineapprovedunknowntargetantagonistDetails
MinaprineapprovedyestargetantagonistDetails
QuetiapineapprovedunknowntargetligandDetails
Tramadolapproved, investigationalunknowntargetantagonistDetails
ClozapineapprovedunknowntargetantagonistDetails
Dexfenfluramineapproved, illicit, investigational, withdrawnunknowntargetagonistDetails
MethysergideapprovedyestargetantagonistDetails
Lorcaserinapproved, withdrawnyestargetagonistDetails
DapoxetineinvestigationalunknowntargetDetails
Sertindoleapproved, investigational, withdrawnyestargetantagonistDetails
Mianserinapproved, investigationalunknowntargetantagonistDetails
Epicept NP-1investigationalunknowntargetDetails
ATHX-105investigationalunknowntargetDetails
AsenapineapprovedunknowntargetantagonistDetails
OcaperidoneinvestigationalunknowntargetDetails
EplivanserininvestigationalunknowntargetDetails
Deramciclaneinvestigationalunknowntargetinverse agonistDetails
DotarizineinvestigationalunknowntargetDetails
Agomelatineapproved, investigationalyestargetantagonistDetails
Pergolideapproved, investigational, vet_approved, withdrawnunknowntargetagonistDetails
Bromocriptineapproved, investigational, withdrawnunknowntargetagonistDetails
Lisurideapproved, investigationalyestargetagonistDetails
CabergolineapprovedunknowntargetagonistDetails
Apomorphineapproved, investigationalunknowntargetagonistDetails
PaliperidoneapprovedyestargetantagonistDetails
Aripiprazoleapproved, investigationalunknowntargetantagonistpartial agonistDetails
Methotrimeprazineapproved, investigationalunknowntargetantagonistDetails
Trazodoneapproved, investigationalyestargetagonistDetails
LoxapineapprovedunknowntargetantagonistDetails
CyproheptadineapprovedyestargetantagonistDetails
Yohimbineapproved, investigational, vet_approvedunknowntargetantagonistDetails
Clomipramineapproved, investigational, vet_approvedyestargetantagonistDetails
Doxepinapproved, investigationalunknowntargetantagonistDetails
Tegaserodapproved, investigational, withdrawnunknowntargetantagonistDetails
Nefazodoneapproved, withdrawnyestargetantagonistDetails
Midomafetamineexperimental, illicit, investigationalyestargetagonistDetails
Chlorpromazineapproved, investigational, vet_approvedunknowntargetbinderDetails
ImipramineapprovedunknowntargetantagonistbinderDetails
AmoxapineapprovedunknowntargetantagonistDetails
NortriptylineapprovedunknowntargetantagonistdownregulatorDetails
TrimipramineapprovedunknowntargetantagonistDetails
ErgotamineapprovedunknowntargetagonistDetails
AmitriptylineapprovedunknowntargetantagonistDetails
Maprotilineapproved, investigationalunknowntargetbinderDetails
Desipramineapproved, investigationalunknowntargetbinderDetails
CaptodiameexperimentalyestargetantagonistDetails
SarpogrelateinvestigationalunknowntargetDetails
FluphenazineapprovedunknowntargetDetails
Fluoxetineapproved, vet_approvedunknowntargetantagonistDetails
4-Bromo-2,5-dimethoxyphenethylamineexperimental, illicityestargetpartial agonistDetails
EtoperidonewithdrawnyestargetagonistDetails
2,5-Dimethoxy-4-ethylthioamphetamineexperimentalunknowntargetagonistDetails
LorpiprazoleapprovedyestargetantagonistDetails
m-ChlorophenylpiperazineinvestigationalyestargetagonistDetails
PizotifenapprovedunknowntargetantagonistDetails
Lofexidineapproved, investigationalnotargetagonistDetails
Aripiprazole lauroxilapproved, investigationalunknowntargetDetails
HaloperidolapprovedyestargetDetails
CyclobenzaprineapprovedunknowntargetantagonistDetails
EscitalopramapprovedunknowntargetinhibitorDetails
Risperidoneapproved, investigationalunknowntargetantagonistDetails
Flupentixolapproved, investigational, withdrawnunknowntargetantagonistDetails
Pimavanserinapproved, investigationalunknowntargetinverse agonistDetails
Dihydroergotamineapproved, investigationalunknowntargetagonistDetails
Cariprazineapproved, investigationalunknowntargetantagonistDetails
Viloxazineapproved, investigational, withdrawnyestargetagonistDetails
IloperidoneapprovedunknowntargetantagonistDetails
EltoprazineinvestigationalyestargetantagonistDetails
CyamemazineexperimentalyestargetantagonistDetails
Serotonininvestigational, nutraceuticalyestargetinhibitorDetails
ClorotepineexperimentalyestargetinhibitorDetails
5-methoxy-N,N-dimethyltryptamineexperimental, illicityestargetinhibitorDetails
MK-212investigationalyestargetmodulatorDetails
RitanserininvestigationalyestargetantagonistDetails
TedatioxetineinvestigationalyestargetmodulatorDetails
VabicaserininvestigationalyestargetmodulatorDetails
PuerarininvestigationalyestargetmodulatorDetails
VolinanserininvestigationalyestargetinhibitorDetails
MetergolineapprovedyestargetantagonistDetails
TiaprideinvestigationalyestargetantagonistDetails
SetiptilineexperimentalunknowntargetantagonistDetails
Dihydroergocristineapproved, experimentalyestargetantagonistDetails
Ergoloid mesylateapprovedyestargetantagonistagonistDetails
DihydroergocornineapprovedyestargetantagonistagonistDetails
Gilteritinibapproved, investigationalnotargetinhibitorDetails
Paroxetineapproved, investigationalunknowntargetDetails
Chlorprothixeneapproved, experimental, investigational, withdrawnyestargetinhibitorDetails
Chlorpromazineapproved, investigational, vet_approvedunknowntargetbinderDetails
Nandrolone decanoateapproved, illicitunknowntargetmodulatorDetails
Ketamineapproved, vet_approvedunknowntargetantagonistDetails
Esmirtazapineinvestigationalunknowntargetinverse agonistDetails