5-hydroxytryptamine receptor 2A
Details
- Name
- 5-hydroxytryptamine receptor 2A
- Kind
- protein
- Synonyms
- 5-HT-2
- 5-HT-2A
- HTR2
- Serotonin receptor 2A
- Gene Name
- HTR2A
- UniProtKB Entry
- P28223Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0000899|5-hydroxytryptamine receptor 2A MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV
- Number of residues
- 471
- Molecular Weight
- 52602.58
- Theoretical pI
- 7.72
- GO Classification
- FunctionsG protein-coupled serotonin receptor activity / Gq/11-coupled serotonin receptor activity / identical protein binding / neurotransmitter receptor activity / protein tyrosine kinase activator activity / protein-containing complex bindingProcesseschemical synaptic transmission / G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger / G protein-coupled serotonin receptor signaling pathway / glycolytic process / intracellular calcium ion homeostasis / phosphatidylinositol 3-kinase/protein kinase B signal transduction / positive regulation of cell population proliferation / positive regulation of cytokine production involved in immune response / positive regulation of cytosolic calcium ion concentration / positive regulation of DNA biosynthetic process / positive regulation of execution phase of apoptosis / positive regulation of heat generation / positive regulation of inflammatory response / positive regulation of neuron apoptotic process / positive regulation of platelet aggregation / presynaptic modulation of chemical synaptic transmission / response to xenobiotic stimulus / sensitizationComponentscytoplasmic vesicle / dendrite / G protein-coupled serotonin receptor complex / glutamatergic synapse / neurofilament / postsynaptic membrane / presynaptic membrane
- General Function
- G-protein coupled receptor for 5-hydroxytryptamine (serotonin) (PubMed:1330647, PubMed:18703043, PubMed:19057895, PubMed:21645528, PubMed:22300836, PubMed:35084960, PubMed:38552625). Also functions as a receptor for various drugs and psychoactive substances, including mescaline, psilocybin, 1-(2,5-dimethoxy-4-iodophenyl)-2-aminopropane (DOI) and lysergic acid diethylamide (LSD) (PubMed:28129538, PubMed:35084960). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of downstream effectors (PubMed:28129538, PubMed:35084960). HTR2A is coupled to G(q)/G(11) G alpha proteins and activates phospholipase C-beta, releasing diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) second messengers that modulate the activity of phosphatidylinositol 3-kinase and promote the release of Ca(2+) ions from intracellular stores, respectively (PubMed:18703043, PubMed:28129538, PubMed:35084960). Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways (PubMed:28129538, PubMed:35084960). Affects neural activity, perception, cognition and mood (PubMed:18297054). Plays a role in the regulation of behavior, including responses to anxiogenic situations and psychoactive substances. Plays a role in intestinal smooth muscle contraction, and may play a role in arterial vasoconstriction (By similarity)
- Specific Function
- 1-(4-iodo-2,5-dimethoxyphenyl)propan-2-amine binding
- Pfam Domain Function
- 7tm_1 (PF00001)
- Signal Regions
- Not Available
- Transmembrane Regions
- 81-97 112-137 147-171 192-215 233-258 323-348 357-382
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0020465|5-hydroxytryptamine receptor 2A (HTR2A) ATGGATATTCTTTGTGAAGAAAATACTTCTTTGAGCTCAACTACGAACTCCCTAATGCAA TTAAATGATGACACCAGGCTCTACAGTAATGACTTTAACTCCGGAGAAGCTAACACTTCT GATGCATTTAACTGGACAGTCGACTCTGAAAATCGAACCAACCTTTCCTGTGAAGGGTGC CTCTCACCGTCGTGTCTCTCCTTACTTCATCTCCAGGAAAAAAACTGGTCTGCTTTACTG ACAGCCGTAGTGATTATTCTAACTATTGCTGGAAACATACTCGTCATCATGGCAGTGTCC CTAGAGAAAAAGCTGCAGAATGCCACCAACTATTTCCTGATGTCACTTGCCATAGCTGAT ATGCTGCTGGGTTTCCTTGTCATGCCCGTGTCCATGTTAACCATCCTGTATGGGTACCGG TGGCCTCTGCCGAGCAAGCTTTGTGCAGTCTGGATTTACCTGGACGTGCTCTTCTCCACG GCCTCCATCATGCACCTCTGCGCCATCTCGCTGGACCGCTACGTCGCCATCCAGAATCCC ATCCACCACAGCCGCTTCAACTCCAGAACTAAGGCATTTCTGAAAATCATTGCTGTTTGG ACCATATCAGTAGGTATATCCATGCCAATACCAGTCTTTGGGCTACAGGACGATTCGAAG GTCTTTAAGGAGGGGAGTTGCTTACTCGCCGATGATAACTTTGTCCTGATCGGCTCTTTT GTGTCATTTTTCATTCCCTTAACCATCATGGTGATCACCTACTTTCTAACTATCAAGTCA CTCCAGAAAGAAGCTACTTTGTGTGTAAGTGATCTTGGCACACGGGCCAAATTAGCTTCT TTCAGCTTCCTCCCTCAGAGTTCTTTGTCTTCAGAAAAGCTCTTCCAGCGGTCGATCCAT AGGGAGCCAGGGTCCTACACAGGCAGGAGGACTATGCAGTCCATCAGCAATGAGCAAAAG GCATGCAAGGTGCTGGGCATCGTCTTCTTCCTGTTTGTGGTGATGTGGTGCCCTTTCTTC ATCACAAACATCATGGCCGTCATCTGCAAAGAGTCCTGCAATGAGGATGTCATTGGGGCC CTGCTCAATGTGTTTGTTTGGATCGGTTATCTCTCTTCAGCAGTCAACCCACTAGTCTAC ACACTGTTCAACAAGACCTATAGGTCAGCCTTTTCACGGTATATTCAGTGTCAGTACAAG GAAAACAAAAAACCATTGCAGTTAATTTTAGTGAACACAATACCGGCTTTGGCCTACAAG TCTAGCCAACTTCAAATGGGACAAAAAAAGAATTCAAAGCAAGATGCCAAGACAACAGAT AATGACTGCTCAATGGTTGCTCTAGGAAAGCAGCATTCTGAAGAGGCTTCTAAAGACAAT AGCGACGGAGTGAATGAAAAGGTGAGCTGTGTGTGA
- Chromosome Location
- 13
- Locus
- 13q14.2
- External Identifiers
Resource Link UniProtKB ID P28223 UniProtKB Entry Name 5HT2A_HUMAN GenBank Protein ID 36431 GenBank Gene ID S42168 GeneCard ID HTR2A GenAtlas ID HTR2A HGNC ID HGNC:5293 PDB ID(s) 6A93, 6A94, 6WGT, 6WH4, 6WHA, 7RAN, 7VOD, 7VOE, 7WC4, 7WC5, 7WC6, 7WC7, 7WC8, 7WC9, 8JT8, 8UWL, 8V6U KEGG ID hsa:3356 IUPHAR/Guide To Pharmacology ID 6 NCBI Gene ID 3356 - General References
- Saltzman AG, Morse B, Whitman MM, Ivanshchenko Y, Jaye M, Felder S: Cloning of the human serotonin 5-HT2 and 5-HT1C receptor subtypes. Biochem Biophys Res Commun. 1991 Dec 31;181(3):1469-78. [Article]
- Chen K, Yang W, Grimsby J, Shih JC: The human 5-HT2 receptor is encoded by a multiple intron-exon gene. Brain Res Mol Brain Res. 1992 Jun;14(1-2):20-6. [Article]
- Cook EH Jr, Fletcher KE, Wainwright M, Marks N, Yan SY, Leventhal BL: Primary structure of the human platelet serotonin 5-HT2A receptor: identify with frontal cortex serotonin 5-HT2A receptor. J Neurochem. 1994 Aug;63(2):465-9. [Article]
- Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
- Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT: The DNA sequence and analysis of human chromosome 13. Nature. 2004 Apr 1;428(6982):522-8. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Stam NJ, Van Huizen F, Van Alebeek C, Brands J, Dijkema R, Tonnaer JA, Olijve W: Genomic organization, coding sequence and functional expression of human 5-HT2 and 5-HT1A receptor genes. Eur J Pharmacol. 1992 Oct 1;227(2):153-62. [Article]
- Becamel C, Figge A, Poliak S, Dumuis A, Peles E, Bockaert J, Lubbert H, Ullmer C: Interaction of serotonin 5-hydroxytryptamine type 2C receptors with PDZ10 of the multi-PDZ domain protein MUPP1. J Biol Chem. 2001 Apr 20;276(16):12974-82. Epub 2001 Jan 9. [Article]
- Becamel C, Gavarini S, Chanrion B, Alonso G, Galeotti N, Dumuis A, Bockaert J, Marin P: The serotonin 5-HT2A and 5-HT2C receptors interact with specific sets of PDZ proteins. J Biol Chem. 2004 May 7;279(19):20257-66. Epub 2004 Feb 26. [Article]
- Nichols DE, Nichols CD: Serotonin receptors. Chem Rev. 2008 May;108(5):1614-41. doi: 10.1021/cr078224o. Epub 2008 May 14. [Article]
- Cussac D, Boutet-Robinet E, Ailhaud MC, Newman-Tancredi A, Martel JC, Danty N, Rauly-Lestienne I: Agonist-directed trafficking of signalling at serotonin 5-HT2A, 5-HT2B and 5-HT2C-VSV receptors mediated Gq/11 activation and calcium mobilisation in CHO cells. Eur J Pharmacol. 2008 Oct 10;594(1-3):32-8. doi: 10.1016/j.ejphar.2008.07.040. Epub 2008 Jul 30. [Article]
- Gonzalez-Maeso J, Ang RL, Yuen T, Chan P, Weisstaub NV, Lopez-Gimenez JF, Zhou M, Okawa Y, Callado LF, Milligan G, Gingrich JA, Filizola M, Meana JJ, Sealfon SC: Identification of a serotonin/glutamate receptor complex implicated in psychosis. Nature. 2008 Mar 6;452(7183):93-7. doi: 10.1038/nature06612. Epub 2008 Feb 24. [Article]
- Knauer CS, Campbell JE, Chio CL, Fitzgerald LW: Pharmacological characterization of mitogen-activated protein kinase activation by recombinant human 5-HT2C, 5-HT2A, and 5-HT2B receptors. Naunyn Schmiedebergs Arch Pharmacol. 2009 May;379(5):461-71. doi: 10.1007/s00210-008-0378-4. Epub 2008 Dec 5. [Article]
- Albizu L, Holloway T, Gonzalez-Maeso J, Sealfon SC: Functional crosstalk and heteromerization of serotonin 5-HT2A and dopamine D2 receptors. Neuropharmacology. 2011 Sep;61(4):770-7. doi: 10.1016/j.neuropharm.2011.05.023. Epub 2011 May 27. [Article]
- Pytliak M, Vargova V, Mechirova V, Felsoci M: Serotonin receptors - from molecular biology to clinical applications. Physiol Res. 2011;60(1):15-25. Epub 2010 Oct 15. [Article]
- Delille HK, Becker JM, Burkhardt S, Bleher B, Terstappen GC, Schmidt M, Meyer AH, Unger L, Marek GJ, Mezler M: Heterocomplex formation of 5-HT2A-mGlu2 and its relevance for cellular signaling cascades. Neuropharmacology. 2012 Jun;62(7):2184-91. doi: 10.1016/j.neuropharm.2012.01.010. Epub 2012 Jan 25. [Article]
- Karaki S, Becamel C, Murat S, Mannoury la Cour C, Millan MJ, Prezeau L, Bockaert J, Marin P, Vandermoere F: Quantitative phosphoproteomics unravels biased phosphorylation of serotonin 2A receptor at Ser280 by hallucinogenic versus nonhallucinogenic agonists. Mol Cell Proteomics. 2014 May;13(5):1273-85. doi: 10.1074/mcp.M113.036558. Epub 2014 Mar 17. [Article]
- Assetta B, Maginnis MS, Gracia Ahufinger I, Haley SA, Gee GV, Nelson CD, O'Hara BA, Allen Ramdial SA, Atwood WJ: 5-HT2 receptors facilitate JC polyomavirus entry. J Virol. 2013 Dec;87(24):13490-8. doi: 10.1128/JVI.02252-13. Epub 2013 Oct 2. [Article]
- Erdmann J, Shimron-Abarbanell D, Rietschel M, Albus M, Maier W, Korner J, Bondy B, Chen K, Shih JC, Knapp M, Propping P, Nothen MM: Systematic screening for mutations in the human serotonin-2A (5-HT2A) receptor gene: identification of two naturally occurring receptor variants and association analysis in schizophrenia. Hum Genet. 1996 May;97(5):614-9. [Article]
- Marshall SE, Bird TG, Hart K, Welsh KI: Unified approach to the analysis of genetic variation in serotonergic pathways. Am J Med Genet. 1999 Dec 15;88(6):621-7. [Article]
- Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES: Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. 1999 Jul;22(3):231-8. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Methysergide approved yes target antagonist Details Mirtazapine approved yes target antagonist Details Cyproheptadine approved yes target antagonist Details Trazodone approved, investigational yes target antagonist Details Cyclobenzaprine approved yes target antagonist Details Nefazodone approved, withdrawn yes target antagonist Details Quetiapine approved yes target antagonist Details Ziprasidone approved yes target antagonist Details Olanzapine approved, investigational yes target antagonist Details Clozapine approved yes target antagonist Details Promazine approved, vet_approved unknown target antagonist Details Chlorpromazine approved, investigational, vet_approved yes target antagonist Details Thioridazine approved, withdrawn yes target antagonist Details Propiomazine approved unknown target antagonist Details Minaprine approved yes target antagonist Details Mesoridazine approved, investigational yes target antagonist Details Aripiprazole approved, investigational yes target antagonist Details Paliperidone approved yes target antagonist Details Ergotamine approved yes target agonist Details Paroxetine approved, investigational unknown target agonist Details Donepezil approved unknown target inducer Details Clomipramine approved, investigational, vet_approved yes target antagonist Details MMDA experimental, illicit yes target agonist Details Chlorprothixene approved, experimental, investigational, withdrawn yes target antagonist Details Epinastine approved, investigational unknown target antagonist Details APD791 investigational unknown target Details Sertindole approved, investigational, withdrawn yes target antagonist Details Flibanserin approved, investigational yes target antagonist Details Nelotanserin investigational yes target modulator Details Mianserin approved, investigational unknown target antagonist Details HY10275 investigational unknown target Details Pimavanserin approved, investigational yes target inverse agonist Details Iloperidone approved yes target antagonist Details BL-1020 investigational unknown target Details Epicept NP-1 investigational unknown target Details Cisapride approved, investigational, withdrawn yes target agonist Details Lumateperone approved, investigational yes target antagonist Details YKP-1358 investigational unknown target Details Asenapine approved yes target antagonist Details Ocaperidone investigational yes target modulator Details Eplivanserin investigational unknown target Details Deramciclane investigational unknown target antagonist Details Aniracetam experimental yes target inhibitor Details Dotarizine investigational unknown target Details Pergolide approved, investigational, vet_approved, withdrawn unknown target agonist Details Bromocriptine approved, investigational, withdrawn unknown target agonist Details Lisuride approved, investigational yes target agonist Details Cabergoline approved unknown target agonist Details Apomorphine approved, investigational unknown target agonist Details Flupentixol approved, investigational, withdrawn yes target antagonist Details Haloperidol approved unknown target other/unknown Details Methotrimeprazine approved, investigational unknown target antagonist Details Molindone approved unknown target antagonist Details Dimethyltryptamine experimental, illicit yes target inhibitor Details Zuclopenthixol approved, investigational unknown target antagonist Details Loxapine approved yes target antagonist Details Amitriptyline approved yes target antagonist Details Doxepin approved, investigational unknown target antagonist Details Desipramine approved, investigational yes target antagonist Details Imipramine approved unknown target antagonist Details Nortriptyline approved yes target antagonist Details Remoxipride approved, withdrawn unknown target other/unknown Details Trimipramine approved unknown target agonist Details Yohimbine approved, investigational, vet_approved unknown target antagonist Details Tegaserod approved, investigational, withdrawn unknown target antagonist Details Fluspirilene approved, investigational unknown target antagonist Details Amisulpride approved, investigational yes target antagonist Details Acepromazine experimental, vet_approved yes target antagonist Details Pipotiazine approved, investigational yes target antagonist Details Thiothixene approved unknown target antagonist Details Midomafetamine experimental, illicit, investigational yes target agonist Details Cinitapride investigational yes target antagonist Details Lurasidone approved, investigational yes target antagonist Details Amperozide experimental unknown target antagonist Details Amoxapine approved unknown target antagonist Details Maprotiline approved, investigational unknown target binder Details Butriptyline approved, withdrawn yes target antagonist Details Brexpiprazole approved, investigational unknown target antagonist Details Perospirone experimental yes target inverse agonist Details Dosulepin approved yes target antagonist Details Fenfluramine approved, illicit, investigational, withdrawn unknown target agonist Details Serotonin investigational, nutraceutical yes target inhibitor Details Ketanserin investigational unknown target inverse agonist Details Ritanserin investigational unknown target inverse agonist Details Sarpogrelate investigational unknown target inverse agonist Details Fluphenazine approved unknown target Details 4-Bromo-2,5-dimethoxyphenethylamine experimental, illicit unknown target partial agonist Details Etoperidone withdrawn yes target antagonist Details Blonanserin investigational yes target antagonist Details 2,5-Dimethoxy-4-ethylthioamphetamine experimental unknown target agonist Details Cannabidiol approved, investigational unknown target agonist Details N-(2-hydroxybenzyl)-2,5-dimethoxy-4-cyanophenylethylamine experimental unknown target agonist Details Lorpiprazole approved yes target antagonist Details Lamotrigine approved, investigational unknown target inhibitor Details Zotepine approved, investigational, withdrawn yes target antagonist Details Pipamperone investigational unknown target agonist Details Pizotifen approved unknown target antagonist Details 5-methoxy-N,N-dimethyltryptamine experimental, illicit unknown target agonist Details Nabiximols investigational unknown target Details Medical Cannabis experimental, investigational unknown target Details Aripiprazole lauroxil approved, investigational yes target antagonist Details Escitalopram approved unknown target inhibitor Details Risperidone approved, investigational yes target antagonist Details Zolmitriptan approved, investigational no target agonist Details Volinanserin investigational yes target antagonist Details Dihydroergotamine approved, investigational unknown target agonist Details Cariprazine approved, investigational unknown target antagonist Details m-Chlorophenylpiperazine investigational yes target agonist Details Cyamemazine experimental yes target antagonist Details Bufotenine experimental, illicit yes target antagonist Details Spiperone investigational yes target inhibitor Details 2,5-Dimethoxyamphetamine experimental, illicit yes target inhibitor Details Mescaline investigational yes target inhibitor Details 4-Bromo-2,5-dimethoxyamphetamine experimental, illicit yes target inhibitor Details Fluanisone experimental yes target inhibitor Details Phenethylamine experimental yes target inhibitor Details 4-Methyl-2,5-dimethoxyamphetamine experimental, illicit yes target inhibitor Details 2,5-Dimethoxy-4-ethylamphetamine experimental, illicit yes target inhibitor Details Lubazodone experimental yes target inhibitor Details Trelanserin investigational yes target modulator Details Lysergic acid diethylamide illicit, investigational, withdrawn yes target inhibitor Details Pruvanserin investigational yes target modulator Details Landipirdine investigational yes target antagonist Details Roluperidone investigational yes target antagonist Details Zicronapine investigational yes target modulator Details Metergoline approved yes target antagonist Details Tryptamine experimental yes target inhibitor Details