Alpha-1-acid glycoprotein 1

Details

Name
Alpha-1-acid glycoprotein 1
Synonyms
  • AGP 1
  • AGP1
  • OMD 1
  • Orosomucoid-1
Gene Name
ORM1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0001842|Alpha-1-acid glycoprotein 1
MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQ
EIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLL
ILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKK
DKCEPLEKQHEKERKQEEGES
Number of residues
201
Molecular Weight
23511.38
Theoretical pI
4.66
GO Classification
Processes
acute-phase response / inflammatory response / negative regulation of interleukin-6 production / negative regulation of tumor necrosis factor production / regulation of immune system process / transport
Components
blood microparticle / extracellular exosome / extracellular region / extracellular space
General Function
Not Available
Specific Function
Functions as transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain. Also binds synthetic drugs and influences their distribution and availability in the body. Appears to function in modulating the activity of the immune system during the acute-phase reaction.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0010649|Alpha-1-acid glycoprotein 1 (ORM1)
ATGGCGCTGTCCTGGGTTCTTACAGTCCTGAGCCTCCTACCTCTGCTGGAAGCCCAGATC
CCATTGTGTGCCAACCTAGTACCGGTGCCCATCACCAACGCCACCCTGGACCGGATCACT
GGCAAGTGGTTTTATATCGCATCGGCCTTTCGAAACGAGGAGTACAATAAGTCGGTTCAG
GAGATCCAAGCAACCTTCTTTTACTTCACCCCCAACAAGACAGAGGACACGATCTTTCTC
AGAGAGTACCAGACCCGACAGGACCAGTGCATCTATAACACCACCTACCTGAATGTCCAG
CGGGAAAATGGGACCATCTCCAGATACGTGGGAGGCCAAGAGCATTTCGCTCACTTGCTG
ATCCTCAGGGACACCAAGACCTACATGCTTGCTTTTGACGTGAACGATGAGAAGAACTGG
GGGCTGTCTGTCTATGCTGACAAGCCAGAGACGACCAAGGAGCAACTGGGAGAGTTCTAC
GAAGCTCTCGACTGCTTGCGCATTCCCAAGTCAGATGTCGTGTACACCGATTGGAAAAAG
GATAAGTGTGAGCCACTGGAGAAGCAGCACGAGAAGGAGAGGAAACAGGAGGAGGGGGAA
TCCTAG
Chromosome Location
9
Locus
9q31-q32
External Identifiers
ResourceLink
UniProtKB IDP02763
UniProtKB Entry NameA1AG1_HUMAN
GenBank Protein ID757907
GenBank Gene IDX02544
GenAtlas IDORM1
HGNC IDHGNC:8498
General References
  1. Dente L, Pizza MG, Metspalu A, Cortese R: Structure and expression of the genes coding for human alpha 1-acid glycoprotein. EMBO J. 1987 Aug;6(8):2289-96. [Article]
  2. Board PG, Jones IM, Bentley AK: Molecular cloning and nucleotide sequence of human alpha 1 acid glycoprotein cDNA. Gene. 1986;44(1):127-31. [Article]
  3. Dente L, Ciliberto G, Cortese R: Structure of the human alpha 1-acid glycoprotein gene: sequence homology with other human acute phase protein genes. Nucleic Acids Res. 1985 Jun 11;13(11):3941-52. [Article]
  4. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
  5. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [Article]
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  7. Schmid K, Kaufmann H, Isemura S, Bauer F, Emura J, Motoyama T, Ishiguro M, Nanno S: Structure of 1 -acid glycoprotein. The complete amino acid sequence, multiple amino acid substitutions, and homology with the immunoglobulins. Biochemistry. 1973 Jul 3;12(14):2711-24. [Article]
  8. Ikenaka T, Ishiguro M, Emura J, Kaufmann H, Isemura S, Bauer W, Schmid K: Isolation and partial characterization of the cyanogen bromide fragments of 1 -acid glycoprotein and the elucidation of the amino acid sequence of the carboxyl-terminal cyanogen bromide fragment. Biochemistry. 1972 Sep 26;11(20):3817-29. [Article]
  9. Schmid K, Burgi W, Collins JH, Nanno S: The disulfide bonds of alpha1-acid glycoprotein. Biochemistry. 1974 Jun 18;13(13):2694-7. [Article]
  10. Treuheit MJ, Costello CE, Halsall HB: Analysis of the five glycosylation sites of human alpha 1-acid glycoprotein. Biochem J. 1992 Apr 1;283 ( Pt 1):105-12. [Article]
  11. Zhang H, Li XJ, Martin DB, Aebersold R: Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry. Nat Biotechnol. 2003 Jun;21(6):660-6. Epub 2003 May 18. [Article]
  12. Hagglund P, Bunkenborg J, Elortza F, Jensen ON, Roepstorff P: A new strategy for identification of N-glycosylated proteins and unambiguous assignment of their glycosylation sites using HILIC enrichment and partial deglycosylation. J Proteome Res. 2004 May-Jun;3(3):556-66. [Article]
  13. Kristiansen TZ, Bunkenborg J, Gronborg M, Molina H, Thuluvath PJ, Argani P, Goggins MG, Maitra A, Pandey A: A proteomic analysis of human bile. Mol Cell Proteomics. 2004 Jul;3(7):715-28. Epub 2004 Apr 14. [Article]
  14. Bunkenborg J, Pilch BJ, Podtelejnikov AV, Wisniewski JR: Screening for N-glycosylated proteins by liquid chromatography mass spectrometry. Proteomics. 2004 Feb;4(2):454-65. [Article]
  15. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [Article]
  16. Fitos I, Visy J, Zsila F, Mady G, Simonyi M: Selective binding of imatinib to the genetic variants of human alpha1-acid glycoprotein. Biochim Biophys Acta. 2006 Nov;1760(11):1704-12. Epub 2006 Aug 25. [Article]
  17. Ramachandran P, Boontheung P, Xie Y, Sondej M, Wong DT, Loo JA: Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry. J Proteome Res. 2006 Jun;5(6):1493-503. [Article]
  18. Zsila F, Iwao Y: The drug binding site of human alpha1-acid glycoprotein: insight from induced circular dichroism and electronic absorption spectra. Biochim Biophys Acta. 2007 May;1770(5):797-809. Epub 2007 Jan 28. [Article]
  19. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [Article]
  20. Nilsson J, Ruetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G: Enrichment of glycopeptides for glycan structure and attachment site identification. Nat Methods. 2009 Nov;6(11):809-11. doi: 10.1038/nmeth.1392. Epub 2009 Oct 18. [Article]
  21. Halim A, Nilsson J, Ruetschi U, Hesse C, Larson G: Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD. Mol Cell Proteomics. 2012 Apr;11(4):M111.013649. doi: 10.1074/mcp.M111.013649. Epub 2011 Dec 14. [Article]
  22. Schonfeld DL, Ravelli RB, Mueller U, Skerra A: The 1.8-A crystal structure of alpha1-acid glycoprotein (Orosomucoid) solved by UV RIP reveals the broad drug-binding activity of this human plasma lipocalin. J Mol Biol. 2008 Dec 12;384(2):393-405. doi: 10.1016/j.jmb.2008.09.020. Epub 2008 Sep 16. [Article]
  23. Yuasa I, Umetsu K, Vogt U, Nakamura H, Nanba E, Tamaki N, Irizawa Y: Human orosomucoid polymorphism: molecular basis of the three common ORM1 alleles, ORM1*F1, ORM1*F2, and ORM1*S. Hum Genet. 1997 Mar;99(3):393-8. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00280Disopyramideapprovednoother/unknownDetails
DB00706Tamsulosinapproved, investigationalnoDetails
DB00908Quinidineapproved, investigationalunknownbinderDetails
DB00946Phenprocoumonapproved, investigationalnoDetails
DB01359Penbutololapproved, investigationalunknownother/unknownDetails
DB01429AprindineexperimentalunknownDetails
DB01418Acenocoumarolapproved, investigationalnoDetails
DB00682WarfarinapprovednoDetails
DB00802Alfentanilapproved, illicitunknownDetails
DB00540NortriptylineapprovednobinderDetails
DB00321AmitriptylineapprovednobinderDetails
DB01232Saquinavirapproved, investigationalunknownDetails
DB00334Olanzapineapproved, investigationalnobinderDetails
DB00543AmoxapineapprovednoDetails
DB00457PrazosinapprovednosubstrateDetails
DB00571Propranololapproved, investigationalnoDetails
DB00458ImipramineapprovednoDetails
DB01151Desipramineapproved, investigationalnoDetails
DB04821Nomifensineapproved, withdrawnnoDetails
DB01156BupropionapprovednoantagonistDetails
DB00934Maprotilineapproved, investigationalnoDetails
DB01426Ajmalineapproved, experimentalunknownDetails
DB00454MeperidineapprovedunknownbinderDetails
DB00731Nateglinideapproved, investigationalunknownDetails
DB08867UlipristalapprovednosubstrateDetails
DB05294VandetanibapprovedunknownbinderDetails
DB05521Telaprevirapproved, withdrawnnosubstrateDetails
DB05812AbirateroneapprovedunknownbinderDetails
DB08881VemurafenibapprovedunknownsubstrateDetails
DB08828Vismodegibapproved, investigationalunknownsubstrateDetails
DB08893MirabegronapprovednobinderDetails
DB08820IvacaftorapprovednocarrierDetails
DB08860PitavastatinapprovedunknownsubstrateDetails
DB08907CanagliflozinapprovedunknownsubstrateDetails
DB00530Erlotinibapproved, investigationalunknownsubstrateDetails
DB00472Fluoxetineapproved, vet_approvedunknownsubstrateDetails
DB00317Gefitinibapproved, investigationalunknownsubstrateDetails
DB00619ImatinibapprovednobinderDetails
DB00864Tacrolimusapproved, investigationalunknownsubstrateDetails
DB08931RiociguatapprovedunknownsubstrateDetails
DB11575GrazoprevirapprovednosubstrateDetails
DB01685TopiroxostatexperimentalunknownbinderDetails
DB00276Amsacrineapproved, investigationalunknownDetails
DB00396Progesteroneapproved, vet_approvedunknownbinderDetails
DB00975DipyridamoleapprovedunknownDetails
DB00281Lidocaineapproved, vet_approvedunknownDetails
DB09236Lacidipineapproved, investigationalunknownbinderDetails
DB09204ArotinololinvestigationalnosubstrateDetails
DB09229AranidipineexperimentalnobinderDetails
DB11148Butambenapproved, withdrawnnosubstrateDetails
DB11637Delamanidapproved, investigationalunknownsubstrateDetails
DB00243Ranolazineapproved, investigationalnobinderDetails
DB01142Doxepinapproved, investigationalnobinderDetails
DB01126Dutasterideapproved, investigationalnobinderDetails
DB00343Diltiazemapproved, investigationalnobinderDetails
DB00481Raloxifeneapproved, investigationalnobinderDetails
DB00490Buspironeapproved, investigationalunknownbinderDetails
DB12978Pexidartinibapproved, investigationalunknownbinderDetails
DB00333MethadoneapprovednoDetails
DB01233Metoclopramideapproved, investigationalunknownbinderDetails
DB01062Oxybutyninapproved, investigationalunknownbinderDetails
DB00661VerapamilapprovedunknownsubstrateDetails
DB01190Clindamycinapproved, vet_approvedunknownsubstrateDetails
DB00246ZiprasidoneapprovedunknownDetails
DB01264DarunavirapprovedunknownsubstrateDetails
DB01601LopinavirapprovedunknownsubstrateDetails
DB00503Ritonavirapproved, investigationalunknownsubstrateDetails
DB11642Pitolisantapproved, investigationalnobinderDetails
DB00734Risperidoneapproved, investigationalunknownbinderDetails
DB12674Lurbinectedinapproved, investigationalunknownbinderDetails
DB11853Relugolixapproved, investigationalunknownbinderDetails
DB15133Tepotinibapproved, investigationalunknownbinderDetails
DB00346Alfuzosinapproved, investigationalunknownbinderDetails
DB00853Temozolomideapproved, investigationalnobinderDetails
DB06237AvanafilapprovedunknownbinderDetails
DB00080Daptomycinapproved, investigationalnobinderDetails
DB12235Estetrolapproved, investigationalunknownbinderDetails
DB01627Lincomycinapproved, vet_approvednobinderDetails
DB16703Belumosudilapproved, investigationalnobinderDetails
DB00877Sirolimusapproved, investigationalnobinderDetails
DB06234Maribavirapproved, investigationalnobinderDetails
DB09074OlaparibapprovedunknownbinderDetails
DB00220NelfinavirapprovednobinderDetails
DB00296RopivacaineapprovednobinderDetails
DB00572Atropineapproved, vet_approvedunknownbinderDetails
DB15149Futibatinibapproved, investigationalnobinderDetails
DB11739Vonoprazanapproved, investigationalunknownbinderDetails
DB05239Cobimetinibapproved, investigationalnobinderDetails
DB00363ClozapineapprovednobinderDetails
DB00349Clobazamapproved, illicitnobinderDetails
DB00683Midazolamapproved, illicitnobinderDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedunknownbinderDetails
DB01041Thalidomideapproved, investigational, withdrawnyesbinderDetails
DB09262ImidafenacininvestigationalnosubstrateDetails
DB11828Neratinibapproved, investigationalnosubstrateDetails
DB00512VancomycinapprovednosubstrateDetails
DB12001Abemaciclibapproved, investigationalunknownbinderDetails
DB09053IbrutinibapprovednosubstrateDetails
DB11641Vinflunineapproved, investigationalnosubstrateDetails
DB14582Patisiranapproved, investigationalunknownligandDetails
DB00289AtomoxetineapprovednobinderDetails
DB00332Ipratropiumapproved, experimentalnobinderDetails
DB00404Alprazolamapproved, illicit, investigationalunknownbinderDetails
DB00421SpironolactoneapprovedunknownDetails
DB00476DuloxetineapprovedunknownligandDetails
DB00497Oxycodoneapproved, illicit, investigationalunknownbinderDetails
DB00813Fentanylapproved, illicit, investigational, vet_approvedunknownbinderDetails
DB01029Irbesartanapproved, investigationalunknownbinderDetails
DB01591SolifenacinapprovedunknownbinderDetails
DB00598LabetalolapprovedunknownsubstrateDetails
DB01203NadololapprovedunknownbinderDetails
DB01611HydroxychloroquineapprovedunknownbinderDetails
DB01045RifampicinapprovedunknownligandDetails
DB11757Istradefyllineapproved, investigationalunknownbinderDetails
DB01195Flecainideapproved, withdrawnunknownbinderDetails
DB00278Argatrobanapproved, investigationalunknownbinderDetails
DB06216AsenapineapprovedunknownbinderDetails
DB01072Atazanavirapproved, investigationalunknownbinderDetails
DB11703Acalabrutinibapproved, investigationalunknownbinderDetails
DB00857Terbinafineapproved, investigational, vet_approvedunknownbinderDetails
DB00950Fexofenadineapproved, investigationalunknownsubstrateDetails
DB01115NifedipineapprovedunknownbinderDetails
DB00938SalmeterolapprovedunknownbinderDetails
DB00608Chloroquineapproved, investigational, vet_approvedunknownbinderDetails
DB12466Favipiravirapproved, investigationalunknowncarrierDetails
DB00907Cocaineapproved, illicitunknownbinderDetails
DB11689Selumetinibapproved, investigationalunknowncarrierDetails
DB14840RipretinibapprovedunknownbinderDetails
DB00808IndapamideapprovedunknownbinderDetails
DB00409Remoxiprideapproved, withdrawnunknownbinderDetails
DB00960Pindololapproved, investigationalunknownbinderDetails
DB01086Benzocaineapproved, investigationalunknownbinderDetails
DB00986Glycopyrroniumapproved, investigational, vet_approvedunknownbinderDetails
DB08932MacitentanapprovednobinderDetails
DB00342Terfenadineapproved, withdrawnunknownbinderregulatorDetails
DB00748CarbinoxamineapprovedunknownbinderregulatorDetails
DB08865Crizotinibapproved, investigationalunknownbinderDetails
DB08930DolutegravirapprovednobinderDetails