Prostaglandin G/H synthase 1
Details
- Name
- Prostaglandin G/H synthase 1
- Synonyms
- 1.14.99.1
- COX-1
- COX1
- Cyclooxygenase-1
- PGH synthase 1
- PGHS-1
- PHS 1
- Prostaglandin H2 synthase 1
- Prostaglandin-endoperoxide synthase 1
- Gene Name
- PTGS1
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0036935|Prostaglandin G/H synthase 1 MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTR TGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRS NLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRF LLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ YQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLY ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKF DPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEA LVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQEL VGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICS PEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL
- Number of residues
- 599
- Molecular Weight
- 68685.82
- Theoretical pI
- 7.39
- GO Classification
- Functionsdioxygenase activity / heme binding / lipid binding / metal ion binding / peroxidase activity / prostaglandin-endoperoxide synthase activityProcessesaging / arachidonic acid metabolic process / cyclooxygenase pathway / inflammatory response / learning / lipid metabolic process / maintenance of blood-brain barrier / memory / negative regulation of epinephrine secretion / negative regulation of norepinephrine secretion / positive regulation of smooth muscle contraction / positive regulation of vasoconstriction / prostaglandin biosynthetic process / regulation of blood pressure / regulation of cell proliferation / response to corticosterone / response to fatty acid / response to organonitrogen compound / response to oxidative stress / sensory perception of pain / small molecule metabolic process / xenobiotic metabolic processComponentscytoplasm / endoplasmic reticulum membrane / extracellular exosome / Golgi apparatus / intracellular membrane-bounded organelle / nuclear envelope / nucleus / photoreceptor outer segment
- General Function
- Prostaglandin-endoperoxide synthase activity
- Specific Function
- Converts arachidonate to prostaglandin H2 (PGH2), a committed step in prostanoid synthesis. Involved in the constitutive production of prostanoids in particular in the stomach and platelets. In gastric epithelial cells, it is a key step in the generation of prostaglandins, such as prostaglandin E2 (PGE2), which plays an important role in cytoprotection. In platelets, it is involved in the generation of thromboxane A2 (TXA2), which promotes platelet activation and aggregation, vasoconstriction and proliferation of vascular smooth muscle cells.
- Pfam Domain Function
- Transmembrane Regions
- Not Available
- Cellular Location
- Microsome membrane
- Gene sequence
>lcl|BSEQ0021254|Prostaglandin G/H synthase 1 (PTGS1) ATGAGCCGGAGTCTCTTGCTCTGGTTCTTGCTGTTCCTGCTCCTGCTCCCGCCGCTCCCC GTCCTGCTCGCGGACCCAGGGGCGCCCACGCCAGTGAATCCCTGTTGTTACTATCCATGC CAGCACCAGGGCATCTGTGTCCGCTTCGGCCTTGACCGCTACCAGTGTGACTGCACCCGC ACGGGCTATTCCGGCCCCAACTGCACCATCCCTGGCCTGTGGACCTGGCTCCGGAATTCA CTGCGGCCCAGCCCCTCTTTCACCCACTTCCTGCTCACTCACGGGCGCTGGTTCTGGGAG TTTGTCAATGCCACCTTCATCCGAGAGATGCTCATGCGCCTGGTACTCACAGTGCGCTCC AACCTTATCCCCAGTCCCCCCACCTACAACTCAGCACATGACTACATCAGCTGGGAGTCT TTCTCCAACGTGAGCTATTACACTCGTATTCTGCCCTCTGTGCCTAAAGATTGCCCCACA CCCATGGGAACCAAAGGGAAGAAGCAGTTGCCAGATGCCCAGCTCCTGGCCCGCCGCTTC CTGCTCAGGAGGAAGTTCATACCTGACCCCCAAGGCACCAACCTCATGTTTGCCTTCTTT GCACAACACTTCACCCACCAGTTCTTCAAAACTTCTGGCAAGATGGGTCCTGGCTTCACC AAGGCCTTGGGCCATGGGGTAGACCTCGGCCACATTTATGGAGACAATCTGGAGCGTCAG TATCAACTGCGGCTCTTTAAGGATGGGAAACTCAAGTACCAGGTGCTGGATGGAGAAATG TACCCGCCCTCGGTAGAAGAGGCGCCTGTGTTGATGCACTACCCCCGAGGCATCCCGCCC CAGAGCCAGATGGCTGTGGGCCAGGAGGTGTTTGGGCTGCTTCCTGGGCTCATGCTGTAT GCCACGCTCTGGCTACGTGAGCACAACCGTGTGTGTGACCTGCTGAAGGCTGAGCACCCC ACCTGGGGCGATGAGCAGCTTTTCCAGACGACCCGCCTCATCCTCATAGGGGAGACCATC AAGATTGTCATCGAGGAGTACGTGCAGCAGCTGAGTGGCTATTTCCTGCAGCTGAAATTT GACCCAGAGCTGCTGTTCGGTGTCCAGTTCCAATACCGCAACCGCATTGCCATGGAGTTC AACCATCTCTACCACTGGCACCCCCTCATGCCTGACTCCTTCAAGGTGGGCTCCCAGGAG TACAGCTACGAGCAGTTCTTGTTCAACACCTCCATGTTGGTGGACTATGGGGTTGAGGCC CTGGTGGATGCCTTCTCTCGCCAGATTGCTGGCCGGATCGGTGGGGGCAGGAACATGGAC CACCACATCCTGCATGTGGCTGTGGATGTCATCAGGGAGTCTCGGGAGATGCGGCTGCAG CCCTTCAATGAGTACCGCAAGAGGTTTGGCATGAAACCCTACACCTCCTTCCAGGAGCTC GTAGGAGAGAAGGAGATGGCAGCAGAGTTGGAGGAATTGTATGGAGACATTGATGCGTTG GAGTTCTACCCTGGACTGCTTCTTGAAAAGTGCCATCCAAACTCTATCTTTGGGGAGAGT ATGATAGAGATTGGGGCTCCCTTTTCCCTCAAGGGTCTCCTAGGGAATCCCATCTGTTCT CCGGAGTACTGGAAGCCGAGCACATTTGGCGGCGAGGTGGGCTTTAACATTGTCAAGACG GCCACACTGAAGAAGCTGGTCTGCCTCAACACCAAGACCTGTCCCTACGTTTCCTTCCGT GTGCCGGATGCCAGTCAGGATGATGGGCCTGCTGTGGAGCGACCATCCACAGAGCTCTGA
- Chromosome Location
- 9
- Locus
- 9q32-q33.3
- External Identifiers
Resource Link UniProtKB ID P23219 UniProtKB Entry Name PGH1_HUMAN GenBank Protein ID 387018 GenBank Gene ID M31822 GenAtlas ID PTGS1 HGNC ID HGNC:9604 - General References
- Yokoyama C, Tanabe T: Cloning of human gene encoding prostaglandin endoperoxide synthase and primary structure of the enzyme. Biochem Biophys Res Commun. 1989 Dec 15;165(2):888-94. [Article]
- Funk CD, Funk LB, Kennedy ME, Pong AS, Fitzgerald GA: Human platelet/erythroleukemia cell prostaglandin G/H synthase: cDNA cloning, expression, and gene chromosomal assignment. FASEB J. 1991 Jun;5(9):2304-12. [Article]
- Takahashi Y, Ueda N, Yoshimoto T, Yamamoto S, Yokoyama C, Miyata A, Tanabe T, Fuse I, Hattori A, Shibata A: Immunoaffinity purification and cDNA cloning of human platelet prostaglandin endoperoxide synthase (cyclooxygenase). Biochem Biophys Res Commun. 1992 Jan 31;182(2):433-8. [Article]
- Diaz A, Reginato AM, Jimenez SA: Alternative splicing of human prostaglandin G/H synthase mRNA and evidence of differential regulation of the resulting transcripts by transforming growth factor beta 1, interleukin 1 beta, and tumor necrosis factor alpha. J Biol Chem. 1992 May 25;267(15):10816-22. [Article]
- Qin N, Zhang SP, Reitz TL, Mei JM, Flores CM: Cloning, expression, and functional characterization of human cyclooxygenase-1 splicing variants: evidence for intron 1 retention. J Pharmacol Exp Ther. 2005 Dec;315(3):1298-305. Epub 2005 Sep 1. [Article]
- Scott BT, Hasstedt SJ, Bovill EG, Callas PW, Valliere JE, Wang L, Wu KK, Long GL: Characterization of the human prostaglandin H synthase 1 gene (PTGS1): exclusion by genetic linkage analysis as a second modifier gene in familial thrombosis. Blood Coagul Fibrinolysis. 2002 Sep;13(6):519-31. [Article]
- Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
- Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Smith WL, DeWitt DL, Garavito RM: Cyclooxygenases: structural, cellular, and molecular biology. Annu Rev Biochem. 2000;69:145-82. [Article]
- Sostres C, Gargallo CJ, Lanas A: Aspirin, cyclooxygenase inhibition and colorectal cancer. World J Gastrointest Pharmacol Ther. 2014 Feb 6;5(1):40-9. doi: 10.4292/wjgpt.v5.i1.40. [Article]
- Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. [Article]
- Goodman JE, Bowman ED, Chanock SJ, Alberg AJ, Harris CC: Arachidonate lipoxygenase (ALOX) and cyclooxygenase (COX) polymorphisms and colon cancer risk. Carcinogenesis. 2004 Dec;25(12):2467-72. Epub 2004 Aug 12. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB00244 Mesalazine approved yes inhibitor Details DB00316 Acetaminophen approved yes inhibitor Details DB00328 Indomethacin approved, investigational unknown inhibitor Details DB00461 Nabumetone approved unknown inhibitor Details DB00465 Ketorolac approved unknown inhibitor Details DB00469 Tenoxicam approved unknown inhibitor Details DB00500 Tolmetin approved unknown inhibitor Details DB00554 Piroxicam approved, investigational unknown inhibitor Details DB00573 Fenoprofen approved unknown inhibitor Details DB00586 Diclofenac approved, vet_approved yes inhibitor Details DB00749 Etodolac approved, investigational, vet_approved unknown inhibitor Details DB00788 Naproxen approved, vet_approved yes inhibitor Details DB00861 Diflunisal approved, investigational unknown inhibitor Details DB00870 Suprofen approved, withdrawn yes inhibitor Details DB00939 Meclofenamic acid approved, vet_approved yes inhibitor Details DB00945 Acetylsalicylic acid approved, vet_approved yes inhibitor Details DB00963 Bromfenac approved, withdrawn unknown inhibitor Details DB01009 Ketoprofen approved, vet_approved unknown inhibitor Details DB01014 Balsalazide approved, investigational yes inhibitor Details DB01050 Ibuprofen approved yes inhibitor Details DB00154 Dihomo-gamma-linolenic acid investigational, nutraceutical yes inhibitor Details DB00159 Icosapent approved, nutraceutical yes inhibitor Details DB00712 Flurbiprofen approved, investigational unknown inhibitor Details DB00784 Mefenamic acid approved unknown inhibitor Details DB01399 Salsalate approved yes inhibitor Details DB00350 Minoxidil approved, investigational unknown inducer Details DB00605 Sulindac approved, investigational unknown inhibitor Details DB00936 Salicylic acid approved, investigational, vet_approved yes inhibitor Details DB01283 Lumiracoxib approved, investigational yes inhibitor Details DB01837 O-acetyl-L-serine experimental unknown Details DB02110 Protoporphyrin Ix Containing Co experimental unknown Details DB02198 2-Bromoacetyl Group experimental unknown Details DB03753 Flurbiprofen Methyl Ester experimental unknown Details DB02379 Beta-D-Glucose experimental unknown Details DB04557 Arachidonic Acid experimental unknown Details DB04817 Metamizole approved, investigational, withdrawn unknown Details DB03783 Phenacetin withdrawn unknown Details DB01892 Hyperforin nutraceutical unknown inhibitor Details DB02709 Resveratrol investigational unknown inhibitor Details DB12445 Nitroaspirin investigational unknown inhibitor Details DB00814 Meloxicam approved, vet_approved unknown inhibitor Details DB02266 Flufenamic acid approved unknown Details DB00991 Oxaprozin approved yes inhibitor Details DB01600 Tiaprofenic acid approved yes inhibitor Details DB01397 Magnesium salicylate experimental yes inhibitor Details DB00250 Dapsone approved, investigational unknown substrate Details DB01041 Thalidomide approved, investigational, withdrawn no substrate Details DB00711 Diethylcarbamazine approved, investigational, vet_approved unknown inhibitor Details DB06725 Lornoxicam approved, investigational yes inhibitor Details DB00821 Carprofen approved, vet_approved, withdrawn unknown inhibitor Details DB00796 Candesartan cilexetil approved unknown substrate Details DB01029 Irbesartan approved, investigational unknown substrate Details DB01181 Ifosfamide approved unknown substrate Details DB05109 Trabectedin approved, investigational unknown substrate Details DB00313 Valproic acid approved, investigational unknown substrate Details DB00857 Terbinafine approved, investigational, vet_approved unknown substrate Details DB00582 Voriconazole approved unknown substrate Details DB01075 Diphenhydramine approved, investigational unknown substrate Details DB00216 Eletriptan approved, investigational unknown substrate Details DB01355 Hexobarbital experimental unknown substrate Details DB00829 Diazepam approved, illicit, investigational, vet_approved unknown substrate Details DB00470 Dronabinol approved, illicit no inhibitor Details DB01198 Zopiclone approved unknown substrate Details DB00471 Montelukast approved unknown substrate Details DB00549 Zafirlukast approved, investigational unknown substrate Details DB00744 Zileuton approved, investigational, withdrawn unknown substrate Details DB00533 Rofecoxib approved, investigational, withdrawn unknown substrate Details DB00412 Rosiglitazone approved, investigational unknown substrate Details DB01221 Ketamine approved, vet_approved unknown substrate Details DB00672 Chlorpropamide approved, investigational unknown substrate Details DB00731 Nateglinide approved, investigational unknown substrate Details DB06737 Zaltoprofen experimental unknown substrate Details DB06739 Seratrodast experimental unknown substrate Details DB06738 Ketobemidone investigational unknown substrate Details DB00812 Phenylbutazone approved, vet_approved yes inhibitor Details DB02773 (3-Chloro-4-Propoxy-Phenyl)-Acetic Acid experimental unknown Details DB02047 (+)-2-(4-biphenyl)propionic acid experimental unknown Details DB07981 2-[1-(4-chlorobenzoyl)-5-methoxy-2-methyl-1H-indol-3-yl]-n-[(1R)-1-(hydroxymethyl)propyl]acetamide experimental unknown Details DB07983 1-(4-IODOBENZOYL)-5-METHOXY-2-METHYL INDOLE-3-ACETIC ACID experimental unknown Details DB07984 2-[1-(4-chlorobenzoyl)-5-methoxy-2-methyl-1H-indol-3-yl]-n-[(1S)-1-(hydroxymethyl)propyl]acetamide experimental unknown Details DB03752 P-(2'-Iodo-5'-Thenoyl)Hydrotropic Acid experimental unknown Details DB03667 Acetic Acid Salicyloyl-Amino-Ester experimental unknown Details DB06802 Nepafenac approved, investigational unknown inhibitor Details DB00795 Sulfasalazine approved yes inhibitor Details DB01435 Antipyrine approved, investigational unknown inhibitor Details DB01419 Antrafenine approved unknown inhibitor Details DB01401 Choline magnesium trisalicylate approved unknown inhibitor Details DB08814 Triflusal approved, investigational yes antagonist Details DB04552 Niflumic acid experimental unknown Details DB00035 Desmopressin approved unknown inducer Details DB00773 Etoposide approved unknown substrate Details DB09213 Dexibuprofen approved, investigational unknown inhibitor Details DB06736 Aceclofenac approved, investigational yes inhibitor Details DB13919 Candesartan experimental unknown substrate Details DB13783 Acemetacin approved, investigational yes antagonist Details DB09215 Droxicam withdrawn yes inhibitor Details DB09212 Loxoprofen approved yes antagonist Details DB09216 Tolfenamic acid approved, investigational yes antagonist Details DB09214 Dexketoprofen approved, investigational unknown antagonist Details DB09214 Dexketoprofen approved, investigational unknown inhibitor Details DB09295 Talniflumate experimental unknown antagonist Details DB09295 Talniflumate experimental unknown inhibitor Details DB09288 Propacetamol experimental yes antagonist Details DB11079 Trolamine salicylate approved yes inhibitor Details DB11071 Phenyl salicylate approved unknown antagonist Details DB13346 Bufexamac approved, withdrawn yes inhibitor Details DB11323 Glycol salicylate approved yes antagonist Details DB11201 Menthyl salicylate approved yes antagonist Details DB13501 Bendazac approved, withdrawn unknown Details DB09061 Cannabidiol approved, investigational unknown inhibitor Details DB14011 Nabiximols investigational unknown inhibitor Details DB14009 Medical Cannabis experimental, investigational unknown inhibitor Details DB13514 Pranoprofen experimental, investigational yes inhibitor Details DB00328 Indomethacin approved, investigational yes inhibitor Details