Prostaglandin G/H synthase 1
Details
- Name
- Prostaglandin G/H synthase 1
- Kind
- protein
- Synonyms
- 1.14.99.1
- COX-1
- COX1
- Cyclooxygenase-1
- PGH synthase 1
- PGHS-1
- PHS 1
- Prostaglandin H2 synthase 1
- Prostaglandin-endoperoxide synthase 1
- Gene Name
- PTGS1
- UniProtKB Entry
- P23219Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0036935|Prostaglandin G/H synthase 1 MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTR TGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRS NLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRF LLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ YQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLY ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKF DPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEA LVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQEL VGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICS PEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL
- Number of residues
- 599
- Molecular Weight
- 68685.82
- Theoretical pI
- 7.39
- GO Classification
- Functionsoxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygenProcessesregulation of cell population proliferationComponentsneuron projection
- General Function
- Dual cyclooxygenase and peroxidase that plays an important role in the biosynthesis pathway of prostanoids, a class of C20 oxylipins mainly derived from arachidonate ((5Z,8Z,11Z,14Z)-eicosatetraenoate, AA, C20:4(n-6)), with a particular role in the inflammatory response. The cyclooxygenase activity oxygenates AA to the hydroperoxy endoperoxide prostaglandin G2 (PGG2), and the peroxidase activity reduces PGG2 to the hydroxy endoperoxide prostaglandin H2 (PGH2), the precursor of all 2-series prostaglandins and thromboxanes. This complex transformation is initiated by abstraction of hydrogen at carbon 13 (with S-stereochemistry), followed by insertion of molecular O2 to form the endoperoxide bridge between carbon 9 and 11 that defines prostaglandins. The insertion of a second molecule of O2 (bis-oxygenase activity) yields a hydroperoxy group in PGG2 that is then reduced to PGH2 by two electrons (PubMed:7947975). Involved in the constitutive production of prostanoids in particular in the stomach and platelets. In gastric epithelial cells, it is a key step in the generation of prostaglandins, such as prostaglandin E2 (PGE2), which plays an important role in cytoprotection. In platelets, it is involved in the generation of thromboxane A2 (TXA2), which promotes platelet activation and aggregation, vasoconstriction and proliferation of vascular smooth muscle cells (Probable). Can also use linoleate (LA, (9Z,12Z)-octadecadienoate, C18:2(n-6)) as substrate and produce hydroxyoctadecadienoates (HODEs) in a regio- and stereospecific manner, being (9R)-HODE ((9R)-hydroxy-(10E,12Z)-octadecadienoate) and (13S)-HODE ((13S)-hydroxy-(9Z,11E)-octadecadienoate) its major products (By similarity)
- Specific Function
- heme binding
- Pfam Domain Function
- An_peroxidase (PF03098)
- Signal Regions
- 1-23
- Transmembrane Regions
- Not Available
- Cellular Location
- Microsome membrane
- Gene sequence
>lcl|BSEQ0021254|Prostaglandin G/H synthase 1 (PTGS1) ATGAGCCGGAGTCTCTTGCTCTGGTTCTTGCTGTTCCTGCTCCTGCTCCCGCCGCTCCCC GTCCTGCTCGCGGACCCAGGGGCGCCCACGCCAGTGAATCCCTGTTGTTACTATCCATGC CAGCACCAGGGCATCTGTGTCCGCTTCGGCCTTGACCGCTACCAGTGTGACTGCACCCGC ACGGGCTATTCCGGCCCCAACTGCACCATCCCTGGCCTGTGGACCTGGCTCCGGAATTCA CTGCGGCCCAGCCCCTCTTTCACCCACTTCCTGCTCACTCACGGGCGCTGGTTCTGGGAG TTTGTCAATGCCACCTTCATCCGAGAGATGCTCATGCGCCTGGTACTCACAGTGCGCTCC AACCTTATCCCCAGTCCCCCCACCTACAACTCAGCACATGACTACATCAGCTGGGAGTCT TTCTCCAACGTGAGCTATTACACTCGTATTCTGCCCTCTGTGCCTAAAGATTGCCCCACA CCCATGGGAACCAAAGGGAAGAAGCAGTTGCCAGATGCCCAGCTCCTGGCCCGCCGCTTC CTGCTCAGGAGGAAGTTCATACCTGACCCCCAAGGCACCAACCTCATGTTTGCCTTCTTT GCACAACACTTCACCCACCAGTTCTTCAAAACTTCTGGCAAGATGGGTCCTGGCTTCACC AAGGCCTTGGGCCATGGGGTAGACCTCGGCCACATTTATGGAGACAATCTGGAGCGTCAG TATCAACTGCGGCTCTTTAAGGATGGGAAACTCAAGTACCAGGTGCTGGATGGAGAAATG TACCCGCCCTCGGTAGAAGAGGCGCCTGTGTTGATGCACTACCCCCGAGGCATCCCGCCC CAGAGCCAGATGGCTGTGGGCCAGGAGGTGTTTGGGCTGCTTCCTGGGCTCATGCTGTAT GCCACGCTCTGGCTACGTGAGCACAACCGTGTGTGTGACCTGCTGAAGGCTGAGCACCCC ACCTGGGGCGATGAGCAGCTTTTCCAGACGACCCGCCTCATCCTCATAGGGGAGACCATC AAGATTGTCATCGAGGAGTACGTGCAGCAGCTGAGTGGCTATTTCCTGCAGCTGAAATTT GACCCAGAGCTGCTGTTCGGTGTCCAGTTCCAATACCGCAACCGCATTGCCATGGAGTTC AACCATCTCTACCACTGGCACCCCCTCATGCCTGACTCCTTCAAGGTGGGCTCCCAGGAG TACAGCTACGAGCAGTTCTTGTTCAACACCTCCATGTTGGTGGACTATGGGGTTGAGGCC CTGGTGGATGCCTTCTCTCGCCAGATTGCTGGCCGGATCGGTGGGGGCAGGAACATGGAC CACCACATCCTGCATGTGGCTGTGGATGTCATCAGGGAGTCTCGGGAGATGCGGCTGCAG CCCTTCAATGAGTACCGCAAGAGGTTTGGCATGAAACCCTACACCTCCTTCCAGGAGCTC GTAGGAGAGAAGGAGATGGCAGCAGAGTTGGAGGAATTGTATGGAGACATTGATGCGTTG GAGTTCTACCCTGGACTGCTTCTTGAAAAGTGCCATCCAAACTCTATCTTTGGGGAGAGT ATGATAGAGATTGGGGCTCCCTTTTCCCTCAAGGGTCTCCTAGGGAATCCCATCTGTTCT CCGGAGTACTGGAAGCCGAGCACATTTGGCGGCGAGGTGGGCTTTAACATTGTCAAGACG GCCACACTGAAGAAGCTGGTCTGCCTCAACACCAAGACCTGTCCCTACGTTTCCTTCCGT GTGCCGGATGCCAGTCAGGATGATGGGCCTGCTGTGGAGCGACCATCCACAGAGCTCTGA
- Chromosome Location
- 9
- Locus
- 9q33.2
- External Identifiers
Resource Link UniProtKB ID P23219 UniProtKB Entry Name PGH1_HUMAN GenBank Protein ID 387018 GenBank Gene ID M31822 GeneCard ID PTGS1 GenAtlas ID PTGS1 HGNC ID HGNC:9604 PDB ID(s) 6Y3C KEGG ID hsa:5742 IUPHAR/Guide To Pharmacology ID 1375 NCBI Gene ID 5742 - General References
- Yokoyama C, Tanabe T: Cloning of human gene encoding prostaglandin endoperoxide synthase and primary structure of the enzyme. Biochem Biophys Res Commun. 1989 Dec 15;165(2):888-94. [Article]
- Funk CD, Funk LB, Kennedy ME, Pong AS, Fitzgerald GA: Human platelet/erythroleukemia cell prostaglandin G/H synthase: cDNA cloning, expression, and gene chromosomal assignment. FASEB J. 1991 Jun;5(9):2304-12. [Article]
- Takahashi Y, Ueda N, Yoshimoto T, Yamamoto S, Yokoyama C, Miyata A, Tanabe T, Fuse I, Hattori A, Shibata A: Immunoaffinity purification and cDNA cloning of human platelet prostaglandin endoperoxide synthase (cyclooxygenase). Biochem Biophys Res Commun. 1992 Jan 31;182(2):433-8. [Article]
- Diaz A, Reginato AM, Jimenez SA: Alternative splicing of human prostaglandin G/H synthase mRNA and evidence of differential regulation of the resulting transcripts by transforming growth factor beta 1, interleukin 1 beta, and tumor necrosis factor alpha. J Biol Chem. 1992 May 25;267(15):10816-22. [Article]
- Qin N, Zhang SP, Reitz TL, Mei JM, Flores CM: Cloning, expression, and functional characterization of human cyclooxygenase-1 splicing variants: evidence for intron 1 retention. J Pharmacol Exp Ther. 2005 Dec;315(3):1298-305. Epub 2005 Sep 1. [Article]
- Scott BT, Hasstedt SJ, Bovill EG, Callas PW, Valliere JE, Wang L, Wu KK, Long GL: Characterization of the human prostaglandin H synthase 1 gene (PTGS1): exclusion by genetic linkage analysis as a second modifier gene in familial thrombosis. Blood Coagul Fibrinolysis. 2002 Sep;13(6):519-31. [Article]
- Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
- Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Smith WL, DeWitt DL, Garavito RM: Cyclooxygenases: structural, cellular, and molecular biology. Annu Rev Biochem. 2000;69:145-82. [Article]
- Sostres C, Gargallo CJ, Lanas A: Aspirin, cyclooxygenase inhibition and colorectal cancer. World J Gastrointest Pharmacol Ther. 2014 Feb 6;5(1):40-9. doi: 10.4292/wjgpt.v5.i1.40. [Article]
- Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. [Article]
- Goodman JE, Bowman ED, Chanock SJ, Alberg AJ, Harris CC: Arachidonate lipoxygenase (ALOX) and cyclooxygenase (COX) polymorphisms and colon cancer risk. Carcinogenesis. 2004 Dec;25(12):2467-72. Epub 2004 Aug 12. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Mesalazine approved yes target inhibitor Details Acetaminophen approved yes target inhibitor Details Indomethacin approved, investigational unknown target inhibitor Details Nabumetone approved unknown target inhibitor Details Ketorolac approved yes target inhibitor Details Tenoxicam approved unknown target inhibitor Details Tolmetin approved unknown target inhibitor Details Piroxicam approved, investigational unknown target inhibitor Details Fenoprofen approved yes target inhibitor Details Diclofenac approved, vet_approved yes target inhibitor Details Etodolac approved, investigational, vet_approved unknown target inhibitor Details Naproxen approved, vet_approved yes target inhibitor Details Diflunisal approved, investigational unknown target inhibitor Details Suprofen approved, withdrawn yes target inhibitor Details Meclofenamic acid approved, vet_approved yes target inhibitor Details Acetylsalicylic acid approved, vet_approved yes target inhibitor Details Bromfenac approved, withdrawn yes target inhibitor Details Ketoprofen approved, vet_approved unknown target inhibitor Details Balsalazide approved, investigational yes target inhibitor Details Ibuprofen approved yes target inhibitor Details Dihomo-gamma-linolenic acid investigational, nutraceutical yes target inhibitor Details Icosapent approved, nutraceutical yes target inhibitor Details Flurbiprofen approved, investigational unknown target inhibitor Details Mefenamic acid approved unknown target inhibitor Details Salsalate approved yes target inhibitor Details Minoxidil approved, investigational unknown target inducer Details Sulindac approved, investigational unknown target inhibitor Details Salicylic acid approved, investigational, vet_approved yes target inhibitor Details Lumiracoxib approved, investigational yes target inhibitor Details O-acetyl-L-serine experimental yes target inhibitor Details Protoporphyrin Ix Containing Co experimental unknown target Details 2-Bromoacetyl Group experimental yes target inhibitor Details Flurbiprofen Methyl Ester experimental unknown target Details Beta-D-Glucose experimental yes target inhibitor Details Arachidonic Acid experimental yes target inhibitor Details Metamizole approved, investigational, withdrawn yes target inhibitor Details Phenacetin withdrawn yes target inhibitor Details Hyperforin nutraceutical yes target inhibitor Details Resveratrol investigational unknown target inhibitor Details Nitroaspirin investigational yes target inhibitor Details Meloxicam approved, vet_approved unknown target inhibitor Details Flufenamic acid approved yes target inhibitor Details Oxaprozin approved yes target inhibitor Details Tiaprofenic acid approved yes target inhibitor Details Magnesium salicylate experimental yes target inhibitor Details Dapsone approved, investigational unknown enzyme substrate Details Thalidomide approved, investigational, withdrawn no enzyme substrate Details Diethylcarbamazine approved, investigational, vet_approved unknown target inhibitor Details Lornoxicam approved, investigational yes target inhibitor Details Carprofen approved, vet_approved, withdrawn unknown target inhibitor Details Candesartan cilexetil approved unknown enzyme substrate Details Irbesartan approved, investigational unknown enzyme substrate Details Ifosfamide approved unknown enzyme substrate Details Trabectedin approved, investigational unknown enzyme substrate Details Valproic acid approved, investigational unknown enzyme substrate Details Terbinafine approved, investigational, vet_approved unknown enzyme substrate Details Voriconazole approved unknown enzyme substrate Details Diphenhydramine approved, investigational unknown enzyme substrate Details Eletriptan approved, investigational unknown enzyme substrate Details Hexobarbital experimental unknown enzyme substrate Details Diazepam approved, illicit, investigational, vet_approved unknown enzyme substrate Details Dronabinol approved, illicit no enzyme inhibitor Details Zopiclone approved unknown enzyme substrate Details Montelukast approved unknown enzyme substrate Details Zafirlukast approved, investigational unknown enzyme substrate Details Zileuton approved, investigational, withdrawn unknown enzyme substrate Details Rofecoxib approved, investigational, withdrawn unknown enzyme substrate Details Rosiglitazone approved, investigational unknown enzyme substrate Details Ketamine approved, vet_approved unknown enzyme substrate Details Chlorpropamide approved, investigational unknown enzyme substrate Details Nateglinide approved, investigational unknown enzyme substrate Details Zaltoprofen experimental unknown enzyme substrate Details Seratrodast experimental unknown enzyme substrate Details Ketobemidone investigational unknown enzyme substrate Details Phenylbutazone approved, vet_approved yes target inhibitor Details (3-Chloro-4-Propoxy-Phenyl)-Acetic Acid experimental yes target inhibitor Details (+)-2-(4-biphenyl)propionic acid experimental yes target inhibitor Details 2-[1-(4-chlorobenzoyl)-5-methoxy-2-methyl-1H-indol-3-yl]-n-[(1R)-1-(hydroxymethyl)propyl]acetamide experimental unknown target Details 1-(4-IODOBENZOYL)-5-METHOXY-2-METHYL INDOLE-3-ACETIC ACID experimental yes target inhibitor Details 2-[1-(4-chlorobenzoyl)-5-methoxy-2-methyl-1H-indol-3-yl]-n-[(1S)-1-(hydroxymethyl)propyl]acetamide experimental unknown target Details P-(2'-Iodo-5'-Thenoyl)Hydrotropic Acid experimental yes target inhibitor Details Acetic Acid Salicyloyl-Amino-Ester experimental yes target inhibitor Details Nepafenac approved, investigational yes target inhibitor Details Sulfasalazine approved yes target inhibitor Details Antipyrine approved, investigational yes target inhibitor Details Antrafenine approved unknown target inhibitor Details Choline magnesium trisalicylate approved yes target inhibitor Details Triflusal approved, investigational yes target antagonist Details Niflumic acid experimental unknown target Details Desmopressin approved unknown enzyme inducer Details Etoposide approved unknown enzyme substrate Details Dexibuprofen approved, investigational unknown target inhibitor Details Aceclofenac approved, investigational yes target inhibitor Details Candesartan experimental unknown enzyme substrate Details Acemetacin approved, investigational yes target antagonist Details Droxicam withdrawn yes target inhibitor Details Loxoprofen approved yes target antagonist Details Tolfenamic acid approved, investigational yes target antagonist Details Dexketoprofen approved, investigational unknown target antagonist Details Dexketoprofen approved, investigational yes enzyme inhibitor Details Talniflumate experimental unknown target antagonist Details Talniflumate experimental unknown enzyme inhibitor Details Propacetamol experimental yes target antagonist Details Trolamine salicylate approved yes target inhibitor Details Phenyl salicylate approved yes target inhibitor Details Bufexamac approved, withdrawn yes target inhibitor Details Glycol salicylate approved yes target antagonist Details Menthyl salicylate approved yes target antagonist Details Bendazac approved, withdrawn unknown target Details Cannabidiol approved, investigational unknown target inhibitor Details Nabiximols investigational unknown target inhibitor Details Medical Cannabis experimental, investigational unknown target inhibitor Details Epicatechin investigational yes target inhibitor Details Esflurbiprofen investigational yes target inhibitor Details Doconexent approved, investigational yes target inhibitor Details Ferroheme investigational yes target inhibitor Details Oxametacin experimental yes target inhibitor Details Resorcinol approved yes target inhibitor Details Honokiol investigational yes target inhibitor Details Cianidanol approved, withdrawn yes target inhibitor Details NCX 701 investigational yes target modulator Details Benzydamine approved yes target inhibitor Details Zomepirac withdrawn yes target modulator Details Indoprofen withdrawn yes target inhibitor Details Aminosalicylic acid approved yes target modulator Details Naproxcinod investigational yes target modulator Details Curcumin approved, investigational yes target inhibitor Details Ampiroxicam investigational yes target modulator Details Morniflumate experimental yes target modulator Details Pelubiprofen investigational yes target modulator Details Felbinac experimental yes target modulator Details Fenbufen approved yes target inhibitor Details Imrecoxib investigational yes target inhibitor Details